Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD4, Human (His)

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TEAD4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tead4-protein-human-his.html

Purity

90.00

Smiles

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

7004 (Gene_ID) Q15561 (M74-E434) (Accession)

Molecular Weight

Approximately 44.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF405S conjugate, 0.1mg/mL
BNC041237-100 1x 100 µL

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carbonic Anhydrase VIII (CPTC-CA8-2), CF568 conjugate, 0.1mg/mL
BNC682232-100 1x 100 µL

Carbonic Anhydrase VIII (CPTC-CA8-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fenpropimorph
TRC-F249500-10MG 10 mg

Fenpropimorph

Sign In for Pricing
View Details
(1R,2S)-anti-Nicotine N'-Oxide Hydrate
TRC-N427505-2.5MG 2.5 mg

(1R,2S)-anti-Nicotine N'-Oxide Hydrate

Sign In for Pricing
View Details
Prostaglandin D2 Receptor (PTGDR) Rabbit Polyclonal Antibody
AP01440PU-N 100 µg

Prostaglandin D2 Receptor (PTGDR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lbp Polyclonal Antibody
D-AB-10445L-01 25 µL

Lbp Polyclonal Antibody

Sign In for Pricing
View Details