Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD4, Human (His)

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TEAD4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tead4-protein-human-his.html

Purity

90.00

Smiles

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

7004 (Gene_ID) Q15561 (M74-E434) (Accession)

Molecular Weight

Approximately 44.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH12 Polyclonal Antibody, Biotin Conjugated
bs-13715R-Biotin 100 µL

CDH12 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Notch3-set siRNA/shRNA/RNAi Lentivector (Mouse)
32016094 4x 500 ng

Notch3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Porcine Ss-A/Ro Antibody ELISA Kit
MBS033872-01 48 Well

Porcine Ss-A/Ro Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Ss-A/Ro Antibody ELISA Kit
MBS033872-02 96 Well

Porcine Ss-A/Ro Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Ss-A/Ro Antibody ELISA Kit
MBS033872-03 5x 96 Well

Porcine Ss-A/Ro Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Ss-A/Ro Antibody ELISA Kit
MBS033872-04 10x 96 Well

Porcine Ss-A/Ro Antibody ELISA Kit

Sign In for Pricing
View Details