CGB-PDE, Mouse (Myc, His)
CGB-PDE protein regulates signal transduction by specifically hydrolyzing cto 5'-GMP, thereby controlling the intracellular concentration of cyclic nucleotides, particularly nitric-oxide-generated cGMP. cGB-PDE Protein, Mouse (Myc, His) is the recombinant mouse-derived cGB-PDE protein, expressed by E. coli , with N-His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
CGB-PDE Protein, Mouse (Myc, His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cgb-pde-protein-mouse-myc-his.html
Purity
92.00
Smiles
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN
Molecular Formula
242202 (Gene_ID) Q8CG03 (D154-N320) (Accession)
Molecular Weight
Approximately 29 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC551037-100 1x 100 µL
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042295-500 1x 500 µL
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882208-500 1x 500 µL
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details