Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGB-PDE, Mouse (Myc, His)

CGB-PDE protein regulates signal transduction by specifically hydrolyzing cto 5'-GMP, thereby controlling the intracellular concentration of cyclic nucleotides, particularly nitric-oxide-generated cGMP. cGB-PDE Protein, Mouse (Myc, His) is the recombinant mouse-derived cGB-PDE protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

CGB-PDE Protein, Mouse (Myc, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cgb-pde-protein-mouse-myc-his.html

Purity

92.00

Smiles

DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN

Molecular Formula

242202 (Gene_ID) Q8CG03 (D154-N320) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD63 Protein, N-GST
HY592012-01 50 µg

Recombinant Human CD63 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CD63 Protein, N-GST
HY592012-02 100 µg

Recombinant Human CD63 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CD63 Protein, N-GST
HY592012-03 1 mg

Recombinant Human CD63 Protein, N-GST

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBR113W Polyclonal Antibody
MBS7156597 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBR113W Polyclonal Antibody

Sign In for Pricing
View Details
Hamster HEART
OORA00451-1EA 1 Each

Hamster HEART

Sign In for Pricing
View Details
ACVR1 (Activin Receptor Type-1, Activin A Receptor, Type 1)
474705 100 µL

ACVR1 (Activin Receptor Type-1, Activin A Receptor, Type 1)

Sign In for Pricing
View Details