Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Product Specifications

Product Name Alternative

IL-33 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human.html

Purity

97.00

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50 (10) :4646-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASF1B Antibody
8C11765-AAT 50 µg

ASF1B Antibody

Sign In for Pricing
View Details
VAC14 (NM_018052) Human Recombinant Protein
TP314195L 1 mg

VAC14 (NM_018052) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human SORD Protein (His Tag)
PKSH033074-01 10 µg

Recombinant Human SORD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SORD Protein (His Tag)
PKSH033074-02 50 µg

Recombinant Human SORD Protein (His Tag)

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF640R conjugate, 0.1mg/mL
BNC401284-500 1x 500 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GM-CSF Antibody
KC-053-01 50 μL

GM-CSF Antibody

Sign In for Pricing
View Details