Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Product Specifications

Product Name Alternative

IL-33 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human.html

Purity

97.00

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50 (10) :4646-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF647 conjugate, 0.1mg/mL
BNC471260-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRAS40 Antibody
KC-1985-01 50 μL

PRAS40 Antibody

Sign In for Pricing
View Details
PRAS40 Antibody
KC-1985-02 100 µL

PRAS40 Antibody

Sign In for Pricing
View Details
PRAS40 Antibody
KC-1985-03 1 mL

PRAS40 Antibody

Sign In for Pricing
View Details
Human CEP95 activation kit by CRISPRa
GA114058 1 Kit

Human CEP95 activation kit by CRISPRa

Sign In for Pricing
View Details
Human FAM53A activation kit by CRISPRa
GA115847 1 Kit

Human FAM53A activation kit by CRISPRa

Sign In for Pricing
View Details