Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Product Specifications

Product Name Alternative

IL-33 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human.html

Purity

97.00

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50 (10) :4646-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D (+) -Biotin
#90072 1x 1 g

D (+) -Biotin

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF647 conjugate, 0.1mg/mL
BNC470759-100 1x 100 µL

Human IgM Immunoglobulin (DA4-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human UPP1 Protein (His Tag)
PKSH033197-01 10 µg

Recombinant Human UPP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human UPP1 Protein (His Tag)
PKSH033197-02 50 µg

Recombinant Human UPP1 Protein (His Tag)

Sign In for Pricing
View Details
Cyanine 3 alkyne [equivalent to Cy3® alkyne]
144-AAT 1 mg

Cyanine 3 alkyne [equivalent to Cy3® alkyne]

Sign In for Pricing
View Details
Recombinant Human CDH1 Protein (His Tag)
PDMH100437-01 20 µg

Recombinant Human CDH1 Protein (His Tag)

Sign In for Pricing
View Details