Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Product Specifications

Product Name Alternative

IL-33 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human.html

Purity

97.00

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50 (10) :4646-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufaf8 Mouse Gene Knockout Kit (CRISPR)
KN500196 1 Kit

Ndufaf8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT3 Mouse Monoclonal Antibody [Clone ID: 7G3H4]
AM06296SU-N 100 µL

STAT3 Mouse Monoclonal Antibody [Clone ID: 7G3H4]

Sign In for Pricing
View Details
Nerve Terminal Staining Kit IIB
#70031-1 1 Kit

Nerve Terminal Staining Kit IIB

Sign In for Pricing
View Details
D-Glucitol-4,5,6-13C3
TRC-G415811-25MG 25 mg

D-Glucitol-4,5,6-13C3

Sign In for Pricing
View Details
2′-Deoxyuridine 4-oxime
TRC-D308930-50MG 50 mg

2′-Deoxyuridine 4-oxime

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), 0.2mg/mL
BNUB1897-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), 0.2mg/mL

Sign In for Pricing
View Details