Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Product Specifications

Product Name Alternative

IL-33 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human.html

Purity

97.00

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50 (10) :4646-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cytokeratin-5 Antibody
RC-15324-01 50 μL

Recombinant Cytokeratin-5 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-5 Antibody
RC-15324-02 100 µL

Recombinant Cytokeratin-5 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-5 Antibody
RC-15324-03 1 mL

Recombinant Cytokeratin-5 Antibody

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF405S conjugate, 0.1mg/mL
BNC041784-100 1x 100 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCXR (NM_001195218) Human Over-expression Lysate
LY434088 100 µg

DCXR (NM_001195218) Human Over-expression Lysate

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A4 (S100A4) ELISA Kit
RDR-S100A4-Hu-01 96 Tests

Human S100 Calcium Binding Protein A4 (S100A4) ELISA Kit

Sign In for Pricing
View Details