Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Product Specifications

Product Name Alternative

IL-33 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human.html

Purity

97.00

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50 (10) :4646-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Human CD66b Antibody[G10F5]
E-AB-F1267E-01 20 Tests

APC Anti-Human CD66b Antibody[G10F5]

Sign In for Pricing
View Details
APC Anti-Human CD66b Antibody[G10F5]
E-AB-F1267E-02 100 Tests

APC Anti-Human CD66b Antibody[G10F5]

Sign In for Pricing
View Details
APC Anti-Human CD66b Antibody[G10F5]
E-AB-F1267E-03 2x 100 Tests

APC Anti-Human CD66b Antibody[G10F5]

Sign In for Pricing
View Details
ITPRIP (NM_033397) Human Over-expression Lysate
LY403247 100 µg

ITPRIP (NM_033397) Human Over-expression Lysate

Sign In for Pricing
View Details
Adrb3 Mouse Gene Knockout Kit (CRISPR)
KN300935RB 1 Kit

Adrb3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NRG1 (NM_001159996) Human Over-expression Lysate
LC431269 20 µg

NRG1 (NM_001159996) Human Over-expression Lysate

Sign In for Pricing
View Details