Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (HEK293, His)

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (HEK293, His) is the recombinant human-derived KGF/FGF-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-hek-293-his.html

Purity

97.17

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PDGFRA (Tyr849) / PDGFRB (Tyr857) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-3320R-BF647-TR 20 µL

Phospho-PDGFRA (Tyr849) / PDGFRB (Tyr857) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
SEZ6 Antibody - C-terminal region
MBS3217003-01 0.1 mL

SEZ6 Antibody - C-terminal region

Sign In for Pricing
View Details
SEZ6 Antibody - C-terminal region
MBS3217003-02 5x 0.1 mL

SEZ6 Antibody - C-terminal region

Sign In for Pricing
View Details
STAT1 Peptide
7195P 0.05 mg

STAT1 Peptide

Sign In for Pricing
View Details
Recombinant Ajellomyces capsulata Altered inheritance of mitochondria protein 31, mitochondrial (AIM31), partial
MBS7065232 Inquire

Recombinant Ajellomyces capsulata Altered inheritance of mitochondria protein 31, mitochondrial (AIM31), partial

Sign In for Pricing
View Details
UHRF1 Polyclonal Antibody, Biotin Conjugated
bs-25668R-Biotin 100 µL

UHRF1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details