Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glycoprotein/G, HRSV (95% Homology, HEK293, His)

A glycoprotein/G protein critical in the immune response forms the interleukin-31 receptor with OSMR.This receptor activates STAT3 and, to a lesser extent, STAT1 and STAT5, playing a critical role in skin immunity and mediating IL31-induced itch, possibly involving TRPA1 and TRPV1.Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His) is the recombinant Virus-derived Glycoprotein/G protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glycoprotein-g-protein-hrsv-95-homology-hek293-his.html

Purity

95.0

Smiles

NHKITSTTTIIQDATNQIKNTTPTYLTQNPQLGISPSNPSDITSLITTILDSTTPGVKSTLQSTTVGTKNTTTTQAQPNKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKRTTTKPTKKPTPKTTKKGPKPQTTKSKEAPTTKPTEEPTINTTKTNIITTLLTSNTTRNPELTSQMETFHSTSSEGNPSPSQVSITSEYPSQPSSPPNTPR

Molecular Formula

/ (Gene_ID) P27022 (N66-R297) (Accession)

Molecular Weight

Approximately 50-100 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL
BNC471577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details