Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2)

Product Specifications

Product Name Alternative

(Basic leucine zipper and W2 domain-containing protein 2)

Abbreviation

Recombinant Human BZW2 protein

Gene Name

BZW2

UniProt

Q9Y6E2

Expression Region

1-419aa

Organism

Homo sapiens (Human)

Target Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Translation initiation regulator which represses non-AUG initiated translation and repeat-associated non-AUG (RAN) initiated translation by acting as a competitive inhibitor of eukaryotic translation initiation factor 5 (EIF5) function. Increases the accuracy of translation initiation by impeding EIF5-dependent translation from non-AUG codons by competing with it for interaction with EIF2S2 within the 43S pre-initiation complex (PIC) in an EIF3C-binding dependent manner.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PADI2 Antibody (4D4)
H00011240-M01 0.1 mg

Mouse Monoclonal PADI2 Antibody (4D4)

Sign In for Pricing
View Details
Cerebroside 1
TBZ0162 unit

Cerebroside 1

Sign In for Pricing
View Details
N-Acetyl-d3-L-threonine-2,3-d2
TRC-A192014-50MG 50 mg

N-Acetyl-d3-L-threonine-2,3-d2

Sign In for Pricing
View Details
Monkey Solute Carrier Family 28 Member 3 (SLC28A3) ELISA Kit
MBS9377252-01 48 Well

Monkey Solute Carrier Family 28 Member 3 (SLC28A3) ELISA Kit

Sign In for Pricing
View Details
Monkey Solute Carrier Family 28 Member 3 (SLC28A3) ELISA Kit
MBS9377252-02 96 Well

Monkey Solute Carrier Family 28 Member 3 (SLC28A3) ELISA Kit

Sign In for Pricing
View Details
Monkey Solute Carrier Family 28 Member 3 (SLC28A3) ELISA Kit
MBS9377252-03 5x 96 Well

Monkey Solute Carrier Family 28 Member 3 (SLC28A3) ELISA Kit

Sign In for Pricing
View Details