Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thrombospondin-2, Mouse (His)

Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Thrombospondin-2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thrombospondin-2-protein-mouse-his.html

Purity

97.00

Smiles

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Molecular Formula

21826 (Gene_ID) Q03350 (G19-A232) (Accession)

Molecular Weight

Approximately 30 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lambda Light Chain (B-Cell Marker) (rLLC/3777), 0.2mg/mL
BNUB3777-100 1x 100 µL

Human Lambda Light Chain (B-Cell Marker) (rLLC/3777), 0.2mg/mL

Sign In for Pricing
View Details
CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: B-A11]
AM31224PU-N 2 mL (200 Tests)

CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: B-A11]

Sign In for Pricing
View Details
CNTNAP5 Human Gene Knockout Kit (CRISPR)
KN421472 1 Kit

CNTNAP5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FNDC8 (Center) Rabbit Polyclonal Antibody
AP51693PU-N 400 µL

FNDC8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-mTOR (S2448) Mouse Monoclonal Antibody [A5D5]
HA600094 100 µL

Phospho-mTOR (S2448) Mouse Monoclonal Antibody [A5D5]

Sign In for Pricing
View Details
CTIP2 (BCL11B) Rabbit Polyclonal Antibody
TA383808 100 µL

CTIP2 (BCL11B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details