Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thrombospondin-2, Mouse (His)

Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Thrombospondin-2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thrombospondin-2-protein-mouse-his.html

Purity

97.00

Smiles

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Molecular Formula

21826 (Gene_ID) Q03350 (G19-A232) (Accession)

Molecular Weight

Approximately 30 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDK1 (29-436) Mouse Monoclonal Antibody [Clone ID: AT2D6]
AM09090PU-N 100 µL

PDK1 (29-436) Mouse Monoclonal Antibody [Clone ID: AT2D6]

Sign In for Pricing
View Details
EIF4E pSer209 Rabbit Polyclonal Antibody
AP02491PU-S 50 µL

EIF4E pSer209 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WY-14643
SIH-531-50MG 50 mg

WY-14643

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL
BNC471577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzohydroxamic Acid
TRC-B203750-5G 5 g

Benzohydroxamic Acid

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB535393 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details