Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-II, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html

Purity

98.0

Smiles

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

16002 (Gene_ID) P09535-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC22D4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV681057 1.0 µg DNA

TSC22D4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
U2af1l4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6270508 1.0 µg DNA

U2af1l4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (MaxLight 750) discontinued
125797-ML750 100 µL

DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LGALS3BP discontinued
391076 200 µL

LGALS3BP discontinued

Sign In for Pricing
View Details
Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) (Biotin)
MBS6142489-01 0.1 mL

Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) (Biotin)

Sign In for Pricing
View Details
Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) (Biotin)
MBS6142489-02 5x 0.1 mL

Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) (Biotin)

Sign In for Pricing
View Details