Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-II, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html

Purity

98.0

Smiles

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

16002 (Gene_ID) P09535-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR2A protein, Human, Recombinant (His)
E51P90799 20 µg

ACVR2A protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Anti-FOXN2 Polyclonal Antibody
MF-0074622-01 50 µL

Anti-FOXN2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FOXN2 Polyclonal Antibody
MF-0074622-02 100 µL

Anti-FOXN2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FOXN2 Polyclonal Antibody
MF-0074622-03 200 µL

Anti-FOXN2 Polyclonal Antibody

Sign In for Pricing
View Details
Human CLEC6A Protein, Fc Tag
KMPH1391 50 µg

Human CLEC6A Protein, Fc Tag

Sign In for Pricing
View Details
ENPP6 (NM_153343) Human Mass Spec Standard
PH306360 10 µg

ENPP6 (NM_153343) Human Mass Spec Standard

Sign In for Pricing
View Details