Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-II, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html

Purity

98.0

Smiles

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

16002 (Gene_ID) P09535-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APBB3 (Amyloid beta A4 precursor Protein-Binding Family B Member 3, Protein Fe65-like 2, Fe65L2, APBB3, FE65L2) (APC) discontinued
302271-APC 200 µL

APBB3 (Amyloid beta A4 precursor Protein-Binding Family B Member 3, Protein Fe65-like 2, Fe65L2, APBB3, FE65L2) (APC) discontinued

Sign In for Pricing
View Details
Phospho-Twist1-Y103 antibody [APR33671G]
APR33671G-01 50 µL

Phospho-Twist1-Y103 antibody [APR33671G]

Sign In for Pricing
View Details
Phospho-Twist1-Y103 antibody [APR33671G]
APR33671G-02 100 µL

Phospho-Twist1-Y103 antibody [APR33671G]

Sign In for Pricing
View Details
Phospho-Twist1-Y103 antibody [APR33671G]
APR33671G-03 200 µL

Phospho-Twist1-Y103 antibody [APR33671G]

Sign In for Pricing
View Details
Phospho-Twist1-Y103 antibody [APR33671G]
APR33671G-04 400 µL

Phospho-Twist1-Y103 antibody [APR33671G]

Sign In for Pricing
View Details
HYAL1 ELISA Kit (Human)
OKBB01150-96W 96 Well With Removable Strips

HYAL1 ELISA Kit (Human)

Sign In for Pricing
View Details