Animal-Free IGF-II, Mouse (His)
The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html
Purity
98.0
Smiles
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Formula
16002 (Gene_ID) P09535-1 (A25-E91) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
ABHDB, ID (ABHD11, WBSCR21, Abhydrolase domain-containing protein 11, Williams-Beuren syndrome chromosomal region 21 protein) (FITC) discontinued
SLC27A6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
DUSP7 (Dual Specificity Protein Phosphatase 7, Dual Specificity Phosphatase 7)
