Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-II, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html

Purity

98.0

Smiles

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

16002 (Gene_ID) P09535-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKM Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV713348 1.0 µg DNA

PFKM Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
NSMCE2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV694339 1.0 µg DNA

NSMCE2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Rarb shRNA (UAS) - Lentiviral mouse Rarb shRNA (UAS, iRFP) (25)
GTR15178778 1 Vial

Lentiviral mouse Rarb shRNA (UAS) - Lentiviral mouse Rarb shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni pyrE Protein (aa 1-202) (strain 81-176)
VAng-Ly2288-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni pyrE Protein (aa 1-202) (strain 81-176)

Sign In for Pricing
View Details
Lentiviral mouse Aox3 shRNA (UAS) - Lentiviral mouse Aox3 shRNA (UAS) (25)
GTR15211205 1 Vial

Lentiviral mouse Aox3 shRNA (UAS) - Lentiviral mouse Aox3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit anti-ROCK2 Antibody, Affinity Purified
A300-047A-T 10 µg

Rabbit anti-ROCK2 Antibody, Affinity Purified

Sign In for Pricing
View Details