Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-II, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html

Purity

98.0

Smiles

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

16002 (Gene_ID) P09535-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICMT Knockout A2780 Polyclonal Cells
ARG29174 1 Million

ICMT Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (MaxLight 650)
126934-ML650 100 µL

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (MaxLight 650)

Sign In for Pricing
View Details
ZNF526 Human shRNA Plasmid Kit (Locus ID 116115)
TR300163 1 Kit

ZNF526 Human shRNA Plasmid Kit (Locus ID 116115)

Sign In for Pricing
View Details
PLV3-U6-CAV1-shRNA2-CopGFP-Puro Plasmid
PVT83650 2 µg

PLV3-U6-CAV1-shRNA2-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
mmu-miR-344d-1-5p miRNA Agomir
MBS8313970-01 5 nmol

mmu-miR-344d-1-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-344d-1-5p miRNA Agomir
MBS8313970-02 10 nmol

mmu-miR-344d-1-5p miRNA Agomir

Sign In for Pricing
View Details