Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-II, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html

Purity

98.0

Smiles

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

16002 (Gene_ID) P09535-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1615903 1.0 µg DNA

PDCD2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant CRPV E5 (aa 1-101) Protein (strain Kansas)
VAng-Wyb2941-1mgEcoli 1 mg (E. coli)

Recombinant CRPV E5 (aa 1-101) Protein (strain Kansas)

Sign In for Pricing
View Details
Bmp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4458806 1.0 µg DNA

Bmp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ZNF583 Mouse Monoclonal Antibody [Clone ID: LBI3E2]
AMM19715V 100 µL

ZNF583 Mouse Monoclonal Antibody [Clone ID: LBI3E2]

Sign In for Pricing
View Details
7-O-Methylchrysin
299866 20 mg

7-O-Methylchrysin

Sign In for Pricing
View Details
Phospho-Gli3 (Ser664) Antibody
MBS9610811-01 0.05 mL

Phospho-Gli3 (Ser664) Antibody

Sign In for Pricing
View Details