Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-II, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-II Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-ii-protein-mouse-his.html

Purity

98.0

Smiles

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

16002 (Gene_ID) P09535-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PINX1 Protein Vector (Rat) (pPM-C-His)
PV294121 500 ng

PINX1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
NOPCHAP1 Human Recombinant Protein
TP725763 50 µg

NOPCHAP1 Human Recombinant Protein

Sign In for Pricing
View Details
SYNJ1 (Synaptojanin-1, Synaptic inositol 1,5-trisphosphate 5-Phosphatase 1, SYNJ1, KIAA0910) (HRP)
MBS6459620-01 0.1 mL

SYNJ1 (Synaptojanin-1, Synaptic inositol 1,5-trisphosphate 5-Phosphatase 1, SYNJ1, KIAA0910) (HRP)

Sign In for Pricing
View Details
SYNJ1 (Synaptojanin-1, Synaptic inositol 1,5-trisphosphate 5-Phosphatase 1, SYNJ1, KIAA0910) (HRP)
MBS6459620-02 5x 0.1 mL

SYNJ1 (Synaptojanin-1, Synaptic inositol 1,5-trisphosphate 5-Phosphatase 1, SYNJ1, KIAA0910) (HRP)

Sign In for Pricing
View Details
Polyclonal FZD6 / Frizzled 6 Antibody (N-Terminus)
APC00116G 0.05mg

Polyclonal FZD6 / Frizzled 6 Antibody (N-Terminus)

Sign In for Pricing
View Details
Anti-Alpha fetoprotein  antibody
STJ16101059 100 µg

Anti-Alpha fetoprotein antibody

Sign In for Pricing
View Details