Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-11 (Il11)

Product Specifications

Product Name Alternative

(IL-11)

Abbreviation

Recombinant Rat Il11 protein

Gene Name

Il11

UniProt

Q99MF5

Expression Region

22-199aa

Organism

Rattus norvegicus (Rat)

Target Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.2 kDa

References & Citations

"Interleukin-11 enhances intestinal absorptive function after ischemia-reperfusion injury." Kuenzler K.A., Pearson P.Y., Schwartz M.Z. J. Pediatr. Surg. 37:457-459 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA1 / HNF3A (FOXA1/1516), 0.2mg/mL
BNUB1516-100 1x 100 µL

FOXA1 / HNF3A (FOXA1/1516), 0.2mg/mL

Sign In for Pricing
View Details
Sort1 Mouse Gene Knockout Kit (CRISPR)
KN516477 1 Kit

Sort1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF640R conjugate, 0.1mg/mL
BNC400252-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), Biotin conjugate, 0.1mg/mL
BNCB0708-500 1x 500 µL

Kappa Light Chain (TB28-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-12263-01 20 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-12263-02 60 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details