Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL16, Human (HEK293, His)

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 176 amino acids (N49-T224) .

Product Specifications

Product Name Alternative

CXCL16 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl16-protein-human-hek293-his.html

Purity

96.90

Smiles

NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSAT

Molecular Formula

58191 (Gene_ID) Q9H2A7 (N30-T205) /NP_071342.2 (N49-T224) (Accession)

Molecular Weight

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[2]Jianhui Sun, et al. A Functional Variant of CXCL16 Is Associated With Predisposition to Sepsis and MODS in Trauma Patients: Genetic Association Studies. Front Genet. 2021 Sep 3;12:720313.|[3]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cno ORF Vector (Rat) (pORF)
ORF065208 1.0 µg DNA

Cno ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Goat Amphiregulin B (AREGB) ELISA Kit
MBS9358806 Inquire

Goat Amphiregulin B (AREGB) ELISA Kit

Sign In for Pricing
View Details
Fam122c (NM_028671) Mouse Tagged ORF Clone Lentiviral Particle
MR213937L3V 200 µL

Fam122c (NM_028671) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Monoclonal EphB6 Antibody (031) [mFluor Violet 500 SE]
NBP2-89327MFV500 0.1 mL

Rabbit Monoclonal EphB6 Antibody (031) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF282 Antibody [Alexa Fluor 647]
NBP2-98101AF647 0.1 mL

Rabbit Polyclonal ZNF282 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Mouse C57 Oviduct Paraffin Sections
MP-410-C57 10 Slides

Mouse C57 Oviduct Paraffin Sections

Sign In for Pricing
View Details