M-CSF, Human (CHO, Tag Free)
M-CSF Protein, Human (CHO) is a hematopoietic growth factor with various glycosylation sites, affects survival and function of the tissue macrophages, and possesses antitumor activity.
Product Specifications
Product Name Alternative
M-CSF Protein, Human (CHO, Tag Free), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/m-csf-protein-human-cho-tag-free.html
Purity
95.00
Smiles
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Molecular Formula
1435 (Gene_ID) P09603-1 (E33-N190) (Accession)
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040499-100 1x 100 µL
Cytokeratin 14 (LL002), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881989-500 1x 500 µL
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401389-500 1x 500 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details