Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGBL1, Human (Myc, His)

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

ITGBL1 Protein, Human (Myc, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/itgbl1-protein-human-myc-his.html

Purity

90.00

Smiles

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

Molecular Formula

9358 (Gene_ID) O95965 (V24-P494) (Accession)

Molecular Weight

Approximately 67 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP10 Rabbit pAb
E2511234 100 µL

FKBP10 Rabbit pAb

Sign In for Pricing
View Details
RPL29P32 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV779384 1.0 µg DNA

RPL29P32 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
SLITRK2 Peptide - C-terminal region
orb1999917 100 µg

SLITRK2 Peptide - C-terminal region

Sign In for Pricing
View Details
ARAP2, NT (ARAP2, CENTD1, KIAA0580, Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2, Centaurin-delta-1, Protein PARX) (MaxLight 650) discontinued
032015-ML650 100 µL

ARAP2, NT (ARAP2, CENTD1, KIAA0580, Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2, Centaurin-delta-1, Protein PARX) (MaxLight 650) discontinued

Sign In for Pricing
View Details
POM121L4P Protein Vector (Human) (pPM-C-HA)
PV056479 500 ng

POM121L4P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
I 309 (CCL1) Human shRNA Lentiviral Particle (Locus ID 6346)
TL319892V 500 µL Each

I 309 (CCL1) Human shRNA Lentiviral Particle (Locus ID 6346)

Sign In for Pricing
View Details