Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (P. pastoris, His)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived MMP-9 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-601a-a-p-pastoris-his.html

Purity

92.00

Smiles

FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) P14780 (F107-D707) (Accession)

Molecular Weight

69 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nelfb Rat shRNA Lentiviral Particle (Locus ID 311796)
TL706366V 500 µL Each

Nelfb Rat shRNA Lentiviral Particle (Locus ID 311796)

Ask
View Details
Zeb1 Rat siRNA Oligo Duplex (Locus ID 25705)
SR503427 1 Kit

Zeb1 Rat siRNA Oligo Duplex (Locus ID 25705)

Ask
View Details
HDAC6 Antibody
R32342 100 µg

HDAC6 Antibody

Ask
View Details
Recombinant Escherichia coli Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1236902-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Escherichia coli Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1236902-02 0.02 mg (Yeast)

Recombinant Escherichia coli Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Escherichia coli Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1236902-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details