Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Human

Sonic Hedgehog (SHH) Protein is a secretory glycoprotein of the Hedgehog family that can self-cleave to form N-SHH. SHH Protein activates Smo by binding to Frizzled and LRP6, inhibits GSK-3β to stabilize β-catenin, and activates FOXM1. SHH Protein also promotes NO release and shortens myocardial APD by phosphorylating eNOS through PI3K/Akt. SHH Protein can promote the maturation of sweat gland cells in three-dimensional culture and play a cardioprotective role in the pig ischemia-reperfusion model[1][2]. SHH Protein, Human is a recombinant human SHH protein expressed in E. coli with tag-free.

Product Specifications

Product Name Alternative

SHH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-human.html

Purity

98.0

Smiles

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

6469 (Gene_ID) Q15465 (C24-G197) (Accession)

Molecular Weight

Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Wang XZ, et al. Sonic hedgehog (Shh) and CC chemokine ligand 2 signaling pathways in asthma. J Chin Med Assoc. 2019;82 (5) :343-350.|[2]Seo H, et al. Upstream Enhancer Elements of Shh Regulate Oral and Dental Patterning. J Dent Res. 2018;97 (9) :1055-1063.|[3]Huang Z, et al. Shh promotes sweat gland cell maturation in three-dimensional culture. Cell Tissue Bank. 2016 Jun;17 (2) :317-25.|[4]Ghaleh B, et al. Cardioprotective effect of sonic hedgehog ligand in pig models of ischemia reperfusion. Theranostics. 2020 Mar 4;10 (9) :4006-4016.|[5]Spinella-Jaegle S, et al. Sonic hedgehog increases the commitment of pluripotent mesenchymal cells into the osteoblastic lineage and abolishes adipocytic differentiation. J Cell Sci. 2001 Jun;114 (Pt 11) :2085-94.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUAK1 rabbit pAb Antibody
orb771830-01 50 μL

NUAK1 rabbit pAb Antibody

Sign In for Pricing
View Details
NUAK1 rabbit pAb Antibody
orb771830-02 100 µL

NUAK1 rabbit pAb Antibody

Sign In for Pricing
View Details
HLA-E Antibody
orb1278504 100 µL

HLA-E Antibody

Sign In for Pricing
View Details
EML1 Protein Lysate
OCOA13112-20UG 20 µg

EML1 Protein Lysate

Sign In for Pricing
View Details
EIF2B2 siRNA Oligos set (Human)
19083171 3x 5 nmol

EIF2B2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Lentiviral human PAFAH1B3 sgRNA gene knockout kit - Lentiviral human PAFAH1B3 sgRNA gene knockout kit (25)
GTR15378051 1 Vial

Lentiviral human PAFAH1B3 sgRNA gene knockout kit - Lentiviral human PAFAH1B3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details