SPRR2B, Human (P.pastoris, Myc, His)
SPRR2B protein, a cross-linked envelope protein in keratinocytes, starts in the cytosol and undergoes transglutaminase-facilitated cross-linking with membrane proteins. This results in the formation of an insoluble envelope beneath the plasma membrane, emphasizing SPRR2B's vital role in the structural integrity and organization of keratinocytes. SPRR2B Protein, Human (P.pastoris, Myc, His) is the recombinant human-derived SPRR2B protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
SPRR2B Protein, Human (P.pastoris, Myc, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sprr2b-protein-human-p-pastoris-myc-his.html
Smiles
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Molecular Formula
6701 (Gene_ID) P35325 (M1-K72) (Accession)
Molecular Weight
Approximately 12.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items