Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRR2B, Human (P.pastoris, Myc, His)

SPRR2B protein, a cross-linked envelope protein in keratinocytes, starts in the cytosol and undergoes transglutaminase-facilitated cross-linking with membrane proteins. This results in the formation of an insoluble envelope beneath the plasma membrane, emphasizing SPRR2B's vital role in the structural integrity and organization of keratinocytes. SPRR2B Protein, Human (P.pastoris, Myc, His) is the recombinant human-derived SPRR2B protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

SPRR2B Protein, Human (P.pastoris, Myc, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sprr2b-protein-human-p-pastoris-myc-his.html

Smiles

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Molecular Formula

6701 (Gene_ID) P35325 (M1-K72) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TPRG1 Adenovirus (Rat)
47390056 1.0 mL

TPRG1 Adenovirus (Rat)

Ask
View Details
Mouse Dgkb Pre-designed siRNA Set B
SI103594B 1 Each

Mouse Dgkb Pre-designed siRNA Set B

Ask
View Details
WC4 (CC57) Alexa Fluor® 488
sc-101844 AF488 200 µg/mL

WC4 (CC57) Alexa Fluor® 488

Ask
View Details
Lentiviral mouse Gtf2ird1 shRNA (UAS) - Lentiviral mouse Gtf2ird1 shRNA (UAS, RFP) (25)
GTR15218435 1 Vial

Lentiviral mouse Gtf2ird1 shRNA (UAS) - Lentiviral mouse Gtf2ird1 shRNA (UAS, RFP) (25)

Ask
View Details
Phosphofructokinase, Liver (PFKL, 6-phosphofructokinase Liver Type, DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, Phosphofructo-1-kinase Isozyme B, PFK-B, Phosphofructokinase 1, Phosphohexokinase) (HRP)
MBS6154138-01 0.1 mL

Phosphofructokinase, Liver (PFKL, 6-phosphofructokinase Liver Type, DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, Phosphofructo-1-kinase Isozyme B, PFK-B, Phosphofructokinase 1, Phosphohexokinase) (HRP)

Ask
View Details
Phosphofructokinase, Liver (PFKL, 6-phosphofructokinase Liver Type, DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, Phosphofructo-1-kinase Isozyme B, PFK-B, Phosphofructokinase 1, Phosphohexokinase) (HRP)
MBS6154138-02 5x 0.1 mL

Phosphofructokinase, Liver (PFKL, 6-phosphofructokinase Liver Type, DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, Phosphofructo-1-kinase Isozyme B, PFK-B, Phosphofructokinase 1, Phosphohexokinase) (HRP)

Ask
View Details