Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRR2B, Human (P.pastoris, Myc, His)

SPRR2B protein, a cross-linked envelope protein in keratinocytes, starts in the cytosol and undergoes transglutaminase-facilitated cross-linking with membrane proteins. This results in the formation of an insoluble envelope beneath the plasma membrane, emphasizing SPRR2B's vital role in the structural integrity and organization of keratinocytes. SPRR2B Protein, Human (P.pastoris, Myc, His) is the recombinant human-derived SPRR2B protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

SPRR2B Protein, Human (P.pastoris, Myc, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sprr2b-protein-human-p-pastoris-myc-his.html

Smiles

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Molecular Formula

6701 (Gene_ID) P35325 (M1-K72) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EPN2 Antibody, Biotin conjugated
A20744-50UL 50 μL

EPN2 Antibody, Biotin conjugated

Ask
View Details
NBD-dodecanoic acid
GW4663-500mg 500 mg

NBD-dodecanoic acid

Ask
View Details
GENLISA™ Human Lipoyl Synthase (Mitochondrial (LIAS) ELISA
KBH5587 1x 96 Well

GENLISA™ Human Lipoyl Synthase (Mitochondrial (LIAS) ELISA

Ask
View Details
Mouse Monoclonal Mouse IgG2a Isotype Control (M2AK) [Alexa Fluor 647]
NBP1-96981AF647 0.5 mL

Mouse Monoclonal Mouse IgG2a Isotype Control (M2AK) [Alexa Fluor 647]

Ask
View Details