Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (C-His)

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (C-His) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-c-his.html

Purity

95.00

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 19.0 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Prostate
CR560862 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF680R conjugate, 0.1mg/mL
BNC810018-100 1x 100 µL

Human Kappa Light Chain (L1C1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF740 conjugate, 0.1mg/mL
BNC742477-100 1x 100 µL

MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STK23 (SRPK3) Human Gene Knockout Kit (CRISPR)
KN415496 1 Kit

STK23 (SRPK3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Nitrobenzaldehyde Semicarbazone
TRC-N492150-250MG 250 mg

2-Nitrobenzaldehyde Semicarbazone

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801242 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details