Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (C-His)

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (C-His) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-c-his.html

Purity

95.00

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 19.0 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dipalmitoyl-sn-glycero-3-phospho-rac-(1-glycerol) Sodium Salt
TRC-D525495-250MG 250 mg

1,2-Dipalmitoyl-sn-glycero-3-phospho-rac-(1-glycerol) Sodium Salt

Sign In for Pricing
View Details
Furazadrol
TRC-F864110-5MG 5 mg

Furazadrol

Sign In for Pricing
View Details
PSD93 (DLG2) (NM_001142699) Human Over-expression Lysate
LY428249 100 µg

PSD93 (DLG2) (NM_001142699) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human TCRVγ9 Antibody[B3]
AN00357M-01 20 Tests

Elab Fluor® 647 Anti-Human TCRVγ9 Antibody[B3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human TCRVγ9 Antibody[B3]
AN00357M-02 100 Tests

Elab Fluor® 647 Anti-Human TCRVγ9 Antibody[B3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human TCRVγ9 Antibody[B3]
AN00357M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human TCRVγ9 Antibody[B3]

Sign In for Pricing
View Details