Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (C-His)

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (C-His) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-c-his.html

Purity

95.00

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 19.0 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTL6A antibody
70R-15564 50 μL

ACTL6A antibody

Sign In for Pricing
View Details
DSPE-PEG-Folate, MW 2000
TCL-00315-01 10 mg

DSPE-PEG-Folate, MW 2000

Sign In for Pricing
View Details
DSPE-PEG-Folate, MW 2000
TCL-00315-02 100 mg

DSPE-PEG-Folate, MW 2000

Sign In for Pricing
View Details
DSPE-PEG-Folate, MW 2000
TCL-00315-03 50 mg

DSPE-PEG-Folate, MW 2000

Sign In for Pricing
View Details
PCNA ORF Vector (Human) (pORF)
ORF007592 1.0 µg DNA

PCNA ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Secretogranin II ELISA kit
GTR10470016 96 Well

Rabbit Secretogranin II ELISA kit

Sign In for Pricing
View Details