Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRG1, Human (His-SUMO)

KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (His-SUMO) is the recombinant human-derived KLRG1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

KLRG1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrg1-protein-human-his-sumo.html

Purity

95.0

Smiles

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Molecular Formula

10219 (Gene_ID) Q96E93 (L60-F195) (Accession)

Molecular Weight

Approximately 31.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab33b ORF Vector (Mouse) (pORF)
38324014 1.0 µg DNA

Rab33b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ARPC4 Immunizing Peptide
MBS426516-01 0.1 mg

ARPC4 Immunizing Peptide

Sign In for Pricing
View Details
ARPC4 Immunizing Peptide
MBS426516-02 5x 0.1 mg

ARPC4 Immunizing Peptide

Sign In for Pricing
View Details
Mouse Monoclonal Ankyrin Brain Antibody (S105-13) [Alexa Fluor 700]
NBP2-59374AF700 100 µL

Mouse Monoclonal Ankyrin Brain Antibody (S105-13) [Alexa Fluor 700]

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-01 48 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-02 96 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details