Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRG1, Human (His-SUMO)

KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (His-SUMO) is the recombinant human-derived KLRG1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

KLRG1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrg1-protein-human-his-sumo.html

Purity

95.0

Smiles

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Molecular Formula

10219 (Gene_ID) Q96E93 (L60-F195) (Accession)

Molecular Weight

Approximately 31.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCAL1 Antibody
GWB-ML818H 50 µg

SMARCAL1 Antibody

Sign In for Pricing
View Details
GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (MaxLight 405)
MBS6302616-01 0.1 mL

GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (MaxLight 405)

Sign In for Pricing
View Details
GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (MaxLight 405)
MBS6302616-02 5x 0.1 mL

GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (MaxLight 405)

Sign In for Pricing
View Details
HEPACAM2 siRNA (Human)
CRJ6633-01 15 nmol

HEPACAM2 siRNA (Human)

Sign In for Pricing
View Details
HEPACAM2 siRNA (Human)
CRJ6633-02 30 nmol

HEPACAM2 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 UvrABC system protein B (uvrB)
MBS7073594-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 UvrABC system protein B (uvrB)

Sign In for Pricing
View Details