Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRG1, Human (His-SUMO)

KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (His-SUMO) is the recombinant human-derived KLRG1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

KLRG1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrg1-protein-human-his-sumo.html

Purity

95.0

Smiles

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Molecular Formula

10219 (Gene_ID) Q96E93 (L60-F195) (Accession)

Molecular Weight

Approximately 31.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuron Specific Enolase, gamma (gNSE) (HRP)
N2175-09-HRP 100 µL

Neuron Specific Enolase, gamma (gNSE) (HRP)

Sign In for Pricing
View Details
ALS (E-2) Alexa Fluor® 594
sc-377131 AF594 200 µg/mL

ALS (E-2) Alexa Fluor® 594

Sign In for Pricing
View Details
Itpka Mouse shRNA Lentiviral Particle (Locus ID 228550)
TL506804V 500 µL Each

Itpka Mouse shRNA Lentiviral Particle (Locus ID 228550)

Sign In for Pricing
View Details
GLCCI1 ORF Vector (Human) (pORF)
ORF020187 1.0 µg DNA

GLCCI1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal Puratrophin-1 Antibody
H00025894-D01P 0.1 mg

Rabbit Polyclonal Puratrophin-1 Antibody

Sign In for Pricing
View Details
PIWIL4 Antibody, FITC conjugated
MBS7103605-01 0.05 mg

PIWIL4 Antibody, FITC conjugated

Sign In for Pricing
View Details