Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B Protein U22 (U22)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human herpesvirus 6B protein U22

Gene Name

U22

UniProt

Q9QJ44

Expression Region

1-202aa

Organism

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Target Sequence

MVPQGWSLAWVSVLYVSVIPSLHIINNENSVFIGTHSETELRHWLIFVKMAQRSGTAWWRMASVPINAYFERDIAFLFNPRCVIETALGSKILCRYNKNIGVVFVDNDTTCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLPRYERFVYYCISVYLFAVAVFCSCWFALDPLFNMWA

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.3 kDa

References & Citations

"Human herpesvirus 6B genome sequence: coding content and comparison with human herpesvirus 6A." Dominguez G., Dambaugh T.R., Stamey F.R., Dewhurst S., Inoue N., Pellett P.E. J. Virol. 73:8040-8052 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIN28B Human Gene Knockout Kit (CRISPR)
KN213537 1 Kit

LIN28B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chloro- (2'-chloro) trityl Polystyrene
H50056033.100G 100 g

Chloro- (2'-chloro) trityl Polystyrene

Sign In for Pricing
View Details
Depdc5 Mouse Gene Knockout Kit (CRISPR)
KN304504RB 1 Kit

Depdc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF647 conjugate, 0.1mg/mL
BNC472937-500 1x 500 µL

CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3 epsilon Rabbit Polyclonal Antibody
ER80501 100 µL

CD3 epsilon Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vitamin D3 Decanoate (>90%)
TRC-V676110-50MG 50 mg

Vitamin D3 Decanoate (>90%)

Sign In for Pricing
View Details