Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human STEAP1 protein (STEAP1), partial

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

Abbreviation

Recombinant Human STEAP1 protein, partial

Gene Name

STEAP1

UniProt

Q9UHE8

Expression Region

3-69aa

Organism

Homo sapiens (Human)

Target Sequence

SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Metalloreductase that has the ability to reduce both Fe (3+) to Fe (2+) and Cu (2+) to Cu (1+) . Uses NAD (+) as acceptor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AADACL3 HDR Plasmid (h)
sc-414285-HDR 20 µg

AADACL3 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)
MBS1137497-01 0.02 mg (E-Coli)

Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)
MBS1137497-02 0.1 mg (E-Coli)

Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)
MBS1137497-03 0.02 mg (Yeast)

Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)
MBS1137497-04 0.1 mg (Yeast)

Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)
MBS1137497-05 0.02 mg (Baculovirus)

Recombinant Chlorobium phaeobacteroides Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details