Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit
abx254683-01 96 Tests

Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit

Sign In for Pricing
View Details
Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit
abx254683-02 5x 96 Tests

Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit

Sign In for Pricing
View Details
Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit
abx254683-03 10x 96 Tests

Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit

Sign In for Pricing
View Details
PLEGFP-Claudin-7 (human)
BZ29709 1 Vial

PLEGFP-Claudin-7 (human)

Sign In for Pricing
View Details
DBNDD2 (NM_001048225) Human Tagged ORF Clone
RG222895 10 µg

DBNDD2 (NM_001048225) Human Tagged ORF Clone

Sign In for Pricing
View Details
FAM220BP Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV725176 1.0 µg DNA

FAM220BP Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details