Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Mitofusin 1 Antibody [DyLight 350]
NBP1-51841UV 0.1 mL

Rabbit Polyclonal Mitofusin 1 Antibody [DyLight 350]

Sign In for Pricing
View Details
Human Placental Protein 13 (PP13) ELISA Kit
EKL62158 96 Tests

Human Placental Protein 13 (PP13) ELISA Kit

Sign In for Pricing
View Details
CGRRF1 Blocking Peptide
MBS9628378-01 1 mg

CGRRF1 Blocking Peptide

Sign In for Pricing
View Details
CGRRF1 Blocking Peptide
MBS9628378-02 5x 1 mg

CGRRF1 Blocking Peptide

Sign In for Pricing
View Details
ZNF773, NT (ZNF773, ZNF419B, Zinc finger protein 773, Zinc finger protein 419B) (MaxLight 650) discontinued
044360-ML650 100 µL

ZNF773, NT (ZNF773, ZNF419B, Zinc finger protein 773, Zinc finger protein 419B) (MaxLight 650) discontinued

Sign In for Pricing
View Details
GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody
TA376815 100 µL

GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details