Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC45
309525 100 µL

CCDC45

Sign In for Pricing
View Details
Anti-PLP2 Antibody, Rabbit Polyclonal
MBS8109273-01 0.1 mL

Anti-PLP2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-PLP2 Antibody, Rabbit Polyclonal
MBS8109273-02 5x 0.1 mL

Anti-PLP2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Mink S100P ELISA Kit
GR239057 96 Tests

Mink S100P ELISA Kit

Sign In for Pricing
View Details
Ypel4 Rat siRNA Oligo Duplex (Locus ID 502643)
SR504385 1 Kit

Ypel4 Rat siRNA Oligo Duplex (Locus ID 502643)

Sign In for Pricing
View Details
Recombinant Thermodesulfovibrio yellowstonii ATP synthase subunit c (atpE), partial
MBS7067692 Inquire

Recombinant Thermodesulfovibrio yellowstonii ATP synthase subunit c (atpE), partial

Sign In for Pricing
View Details