Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG2 (ATP-binding cassette sub-family G member 2)
029929 100 µL

ABCG2 (ATP-binding cassette sub-family G member 2)

Sign In for Pricing
View Details
Olr1078 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV664432 1.0 µg DNA

Olr1078 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
LRRC67, CT (PPP1R42, LRRC67, Protein phosphatase 1 regulatory subunit 42, Leucine-rich repeat-containing protein 67) (MaxLight 550) discontinued
037970-ML550 100 µL

LRRC67, CT (PPP1R42, LRRC67, Protein phosphatase 1 regulatory subunit 42, Leucine-rich repeat-containing protein 67) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Bovine Deoxypyridinoline (DPD) ELISA Kit
OM622432 96 Strip Well

Bovine Deoxypyridinoline (DPD) ELISA Kit

Sign In for Pricing
View Details
RPL12P11 AAV siRNA Pooled Vector
40763161 1.0 µg

RPL12P11 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Histidine--tRNA Ligase, Cytoplasmic (HARS) Antibody
abx321377-01 20 µL

Histidine--tRNA Ligase, Cytoplasmic (HARS) Antibody

Sign In for Pricing
View Details