Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

En1 Mouse qPCR Primer Pair (NM_010133)
MP204218 200 Reactions

En1 Mouse qPCR Primer Pair (NM_010133)

Sign In for Pricing
View Details
SENP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
43372151 3x 1.0 µg DNA

SENP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Jerky protein homolog (JRK) Antibody (FITC)
abx345882-01 50 µL

Jerky protein homolog (JRK) Antibody (FITC)

Sign In for Pricing
View Details
Jerky protein homolog (JRK) Antibody (FITC)
abx345882-02 100 µL

Jerky protein homolog (JRK) Antibody (FITC)

Sign In for Pricing
View Details
Jerky protein homolog (JRK) Antibody (FITC)
abx345882-03 200 µL

Jerky protein homolog (JRK) Antibody (FITC)

Sign In for Pricing
View Details
Jerky protein homolog (JRK) Antibody (FITC)
abx345882-04 1 mL

Jerky protein homolog (JRK) Antibody (FITC)

Sign In for Pricing
View Details