Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL4 Rabbit Polyclonal Antibody
TA358739 100 µL

RPL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H2-T23 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4363804 1.0 µg DNA

H2-T23 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human Protein BEAN1 (BEAN1) ELISA Kit
abx503666 96 Tests

Human Protein BEAN1 (BEAN1) ELISA Kit

Sign In for Pricing
View Details
ANKMY2 Polyclonal Antibody
MBS2521561-01 0.02 mL

ANKMY2 Polyclonal Antibody

Sign In for Pricing
View Details
ANKMY2 Polyclonal Antibody
MBS2521561-02 0.06 mL

ANKMY2 Polyclonal Antibody

Sign In for Pricing
View Details
ANKMY2 Polyclonal Antibody
MBS2521561-03 0.12 mL

ANKMY2 Polyclonal Antibody

Sign In for Pricing
View Details