Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIGYF2 Protein Vector (Human) (pPB-N-His)
PV080586 500 ng

GIGYF2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
EIF3S1 (EIF3J) Human qPCR Template Standard (NM_003758)
HK202753 1 Kit

EIF3S1 (EIF3J) Human qPCR Template Standard (NM_003758)

Sign In for Pricing
View Details
Mouse anti-human Protein S100-B Monoclonal Antibody
MBS1496933-01 0.05 mg

Mouse anti-human Protein S100-B Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti-human Protein S100-B Monoclonal Antibody
MBS1496933-02 0.1 mg

Mouse anti-human Protein S100-B Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti-human Protein S100-B Monoclonal Antibody
MBS1496933-03 5x 0.1 mg

Mouse anti-human Protein S100-B Monoclonal Antibody

Sign In for Pricing
View Details
Defa21 ORF Vector (Mouse) (pORF)
ORF042850 1.0 µg DNA

Defa21 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details