Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane protein 147 (TMEM147) Mouse ELISA Kit
H8245 96 Tests

Transmembrane protein 147 (TMEM147) Mouse ELISA Kit

Sign In for Pricing
View Details
Mouse Pancreastatin/Chromogranin A (CHGA) ELISA Kit
abx515804 96 Well

Mouse Pancreastatin/Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details
Mouse CRH (Corticotropin Releasing Hormone) ValidElisa Kit
EK343288 96 Well

Mouse CRH (Corticotropin Releasing Hormone) ValidElisa Kit

Sign In for Pricing
View Details
PDLIM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV663760 1.0 µg DNA

PDLIM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Chicken Fatty Acid Synthase (FASN) ELISA Kit
abx575933-01 96 Tests

Chicken Fatty Acid Synthase (FASN) ELISA Kit

Sign In for Pricing
View Details
Chicken Fatty Acid Synthase (FASN) ELISA Kit
abx575933-02 5x 96 Tests

Chicken Fatty Acid Synthase (FASN) ELISA Kit

Sign In for Pricing
View Details