Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM6A (Lysine-specific Demethylase 6A, 11411-, Histone Demethylase UTX, Ubiquitously Transcribed TPR Protein on the X Chromosome, Ubiquitously Transcribed X Chromosome Tetratricopeptide Repeat Protein, Kdm6a, Utx) (Biotin) discontinued
302517-Biotin 200 µL

KDM6A (Lysine-specific Demethylase 6A, 11411-, Histone Demethylase UTX, Ubiquitously Transcribed TPR Protein on the X Chromosome, Ubiquitously Transcribed X Chromosome Tetratricopeptide Repeat Protein, Kdm6a, Utx) (Biotin) discontinued

Sign In for Pricing
View Details
SFMBT2 Recombinant Protein Antigen
NBP2-34005PEP 0.1 mL

SFMBT2 Recombinant Protein Antigen

Sign In for Pricing
View Details
NLK Knockout HCT116 Polyclonal Cells
ARG7256 1 Million

NLK Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Cluster of differentiation 62p (CD62p) ELISA Kit
YP-W73988-01 48 Tests

Rabbit Cluster of differentiation 62p (CD62p) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cluster of differentiation 62p (CD62p) ELISA Kit
YP-W73988-02 96 Tests

Rabbit Cluster of differentiation 62p (CD62p) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g33370 Polyclonal Antibody
MBS7190022 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g33370 Polyclonal Antibody

Sign In for Pricing
View Details