Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Asp-OAll
MBS5806981 Inquire

Fmoc-Asp-OAll

Sign In for Pricing
View Details
MIP-1a (Macrophage Inflammatory Protein 1 α) Chicken ELISA Kit
F0105 96 Tests

MIP-1a (Macrophage Inflammatory Protein 1 α) Chicken ELISA Kit

Sign In for Pricing
View Details
Olr602 (NM_001000333) Rat Tagged ORF Clone Lentiviral Particle
RR204607L3V 200 µL

Olr602 (NM_001000333) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PHC3 sgRNA CRISPR Lentivector (Human) (Target 3)
K1638404 1.0 µg DNA

PHC3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila murB Protein (aa 1-303)
VAng-Lsx04423-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila murB Protein (aa 1-303)

Sign In for Pricing
View Details
Bovine Prokineticin Receptor 1 (PKR1) ELISA Kit
RDR-PKR1-b-96Tests 96 Tests

Bovine Prokineticin Receptor 1 (PKR1) ELISA Kit

Sign In for Pricing
View Details