Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL10A1 Blocking Peptide
MBS9631428-01 1 mg

COL10A1 Blocking Peptide

Sign In for Pricing
View Details
COL10A1 Blocking Peptide
MBS9631428-02 5x 1 mg

COL10A1 Blocking Peptide

Sign In for Pricing
View Details
Human HAS2 ELISA Kit
E019068 1 Each

Human HAS2 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Kcnf1 shRNA (UAS) - Lentiviral mouse Kcnf1 shRNA (UAS, GFP) plasmid
GTR15270754 1 Vial

Lentiviral mouse Kcnf1 shRNA (UAS) - Lentiviral mouse Kcnf1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rbm20 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3513403 1.0 µg DNA

Rbm20 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Lhcgr sgRNA CRISPR Lentivector set (Rat)
K6835001 3x 1.0 µg

Lhcgr sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details