Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARHGAP15 knockdown cell line
ABC-KD0885 1 Vial

Human ARHGAP15 knockdown cell line

Sign In for Pricing
View Details
Mouse Monoclonal ErbB4/Her4 Antibody (HFR1) [Alexa Fluor 405]
NB100-2662AF405 0.1 mL

Mouse Monoclonal ErbB4/Her4 Antibody (HFR1) [Alexa Fluor 405]

Sign In for Pricing
View Details
Human ZNF580 (NM_207115) AAV Particle
RC204398A1V 250 µL

Human ZNF580 (NM_207115) AAV Particle

Sign In for Pricing
View Details
Monosodium urate (ready-to-use)
INH-019 10 mg

Monosodium urate (ready-to-use)

Sign In for Pricing
View Details
Pax4 sgRNA CRISPR Lentivector set (Mouse)
K4432001 3x 1.0 µg

Pax4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Olfr569 Mouse qPCR Primer Pair (NM_147088)
MP210022 200 Reactions

Olfr569 Mouse qPCR Primer Pair (NM_147088)

Sign In for Pricing
View Details