Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRPV2 Knockout HEK293T cell line
GTR15413897 1 Vial

Human TRPV2 Knockout HEK293T cell line

Sign In for Pricing
View Details
HMBOX1 (NM_024567) Human Recombinant Protein
PH37559M5 20 µg

HMBOX1 (NM_024567) Human Recombinant Protein

Sign In for Pricing
View Details
Ass1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4559102 1.0 µg DNA

Ass1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
H-AP14 primer
H-AP14 150 µL

H-AP14 primer

Sign In for Pricing
View Details
Phenacetin
sc-257998A 250 g

Phenacetin

Sign In for Pricing
View Details
Anti-2019-Ncov S1 Mab (5D9)
FY-PN53105 1 mg

Anti-2019-Ncov S1 Mab (5D9)

Sign In for Pricing
View Details