Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD2 Protein Vector (Rat) (pPM-C-HA)
PV292964 500 ng

PDCD2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
HECTD3 (NM_024602) Human Tagged ORF Clone
RC220357 10 µg

HECTD3 (NM_024602) Human Tagged ORF Clone

Sign In for Pricing
View Details
RGD1564941 3'UTR GFP Stable Cell Line
TU269067 1.0 mL

RGD1564941 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (Biotin)
MBS6173888-01 0.1 mL

TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (Biotin)

Sign In for Pricing
View Details
TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (Biotin)
MBS6173888-02 5x 0.1 mL

TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (Biotin)

Sign In for Pricing
View Details
Phex (NM_011077) Mouse Untagged Clone
MC221291 10 µg

Phex (NM_011077) Mouse Untagged Clone

Sign In for Pricing
View Details