Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Citrate 9NC (3.2%/PT Tube)
PT-4-N 100 PCS

Sodium Citrate 9NC (3.2%/PT Tube)

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida rplI Protein (aa 1-149)
VAng-Cr7304-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida rplI Protein (aa 1-149)

Sign In for Pricing
View Details
RPL21P108 Adenovirus (Human)
40984051 1.0 mL

RPL21P108 Adenovirus (Human)

Sign In for Pricing
View Details
UG-650
HY-170975 1 Each

UG-650

Sign In for Pricing
View Details
VprBP CRISPR All-in-one AAV vector set (with saCas9)(Rat)
50163156 3x 1.0 µg DNA

VprBP CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal Testis Development Related Protein Antibody
NBP2-83577-0.1mL 0.1 mL

Rabbit Polyclonal Testis Development Related Protein Antibody

Sign In for Pricing
View Details