Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Syndecan 4 ELISA Kit
CEK1673 96 Tests

Human Syndecan 4 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Carboxypeptidase M Antibody [DyLight 488]
NBP2-99754G 0.1 mL

Rabbit Polyclonal Carboxypeptidase M Antibody [DyLight 488]

Sign In for Pricing
View Details
hsa-miR-638 Primers
MPH01939 150 µL - 10 µM

hsa-miR-638 Primers

Sign In for Pricing
View Details
Recombinant Human V-Set and Transmembrane Domain-Containing 2A/VSTM2A (C-6His)
32-8404-10 10 µg

Recombinant Human V-Set and Transmembrane Domain-Containing 2A/VSTM2A (C-6His)

Sign In for Pricing
View Details
Mouse anti Human HLA Class I Heavy Chain (Restricted expression)
MUB2037P 0.1 mg

Mouse anti Human HLA Class I Heavy Chain (Restricted expression)

Sign In for Pricing
View Details
Estrogen Receptor, alpha (ER)
E3565-10J 100 µg

Estrogen Receptor, alpha (ER)

Sign In for Pricing
View Details