Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBSCR27 sgRNA CRISPR Lentivector set (Human)
K2627601 3x 1.0 µg

WBSCR27 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human ZNF682 shRNA Plasmid
abx964011-01 150 µg

Human ZNF682 shRNA Plasmid

Sign In for Pricing
View Details
Human ZNF682 shRNA Plasmid
abx964011-02 300 µg

Human ZNF682 shRNA Plasmid

Sign In for Pricing
View Details
DEFB110 (NM_001037728) Human Tagged ORF Clone Lentiviral Particle
RC224608L4V 200 µL

DEFB110 (NM_001037728) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
N-Cbz-L-Cysteine
HY-160255 1 Each

N-Cbz-L-Cysteine

Sign In for Pricing
View Details
DCUN1D1 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. cerevisiae), DCUN1L1, RP42, SCCRO, SCRO, Tes3) (MaxLight 550)
MBS6216523-01 0.1 mL

DCUN1D1 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. cerevisiae), DCUN1L1, RP42, SCCRO, SCRO, Tes3) (MaxLight 550)

Sign In for Pricing
View Details