Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Mouse IgG (H + L) (rhodamine)
43R-1343 1 mg

Goat anti Mouse IgG (H + L) (rhodamine)

Sign In for Pricing
View Details
FOXQ1 (NM_033260) Human Over-expression Lysate
LH13147V 100 µg

FOXQ1 (NM_033260) Human Over-expression Lysate

Sign In for Pricing
View Details
BMPR2 (NM_001204) Human Over-expression Lysate
LH05610V 100 µg

BMPR2 (NM_001204) Human Over-expression Lysate

Sign In for Pricing
View Details
5730409K12Rik Mouse shRNA Plasmid (Locus ID 70494)
TL514205 1 Kit

5730409K12Rik Mouse shRNA Plasmid (Locus ID 70494)

Sign In for Pricing
View Details
Idnk Rat siRNA Oligo Duplex (Locus ID 498695)
SR515084 1 Kit

Idnk Rat siRNA Oligo Duplex (Locus ID 498695)

Sign In for Pricing
View Details
PPP1R16A (Protein Phosphatase 1 Regulatory Subunit 16A, Myosin Phosphatase-targeting Subunit 3, MYPT3, MGC14333) (MaxLight 550)
131690-ML550 100 µL

PPP1R16A (Protein Phosphatase 1 Regulatory Subunit 16A, Myosin Phosphatase-targeting Subunit 3, MYPT3, MGC14333) (MaxLight 550)

Sign In for Pricing
View Details