Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Portable pH meter
25-PPM100 1 Unit

Portable pH meter

Sign In for Pricing
View Details
Recombinant Mouse Taste receptor type 2 member 143 (Tas2r143)
MBS7030936-01 0.02 mg

Recombinant Mouse Taste receptor type 2 member 143 (Tas2r143)

Sign In for Pricing
View Details
Recombinant Mouse Taste receptor type 2 member 143 (Tas2r143)
MBS7030936-02 0.1 mg

Recombinant Mouse Taste receptor type 2 member 143 (Tas2r143)

Sign In for Pricing
View Details
Recombinant Mouse Taste receptor type 2 member 143 (Tas2r143)
MBS7030936-03 5x 0.1 mg

Recombinant Mouse Taste receptor type 2 member 143 (Tas2r143)

Sign In for Pricing
View Details
Ephrin A3 (EFNA3) (NM_004952) Human Recombinant Protein
TP761963 50 µg

Ephrin A3 (EFNA3) (NM_004952) Human Recombinant Protein

Sign In for Pricing
View Details
Purified Recombinant Amphiphysin protein (His tag) (GST tag)
MBS5308512-01 1 mg

Purified Recombinant Amphiphysin protein (His tag) (GST tag)

Sign In for Pricing
View Details