Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbx5 3'UTR Lenti-reporter-Luc Vector
46310086 1.0 µg

Tbx5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
AXIN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0161207 1.0 µg DNA

AXIN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal Translin Antibody [DyLight 594]
NBP1-76581DL594 0.1 mL

Rabbit Polyclonal Translin Antibody [DyLight 594]

Sign In for Pricing
View Details
UGT2A1 Human shRNA Plasmid Kit (Locus ID 10941)
TL308499 1 Kit

UGT2A1 Human shRNA Plasmid Kit (Locus ID 10941)

Sign In for Pricing
View Details
Mouse Monoclonal Chromogranin A Antibody (SPM585) - Azide and BSA Free
NBP2-34815-0.1mg 0.1 mg

Mouse Monoclonal Chromogranin A Antibody (SPM585) - Azide and BSA Free

Sign In for Pricing
View Details
Phospho-ERK1 (T202/Y204) /ERK2 (T185/Y187) Recombinant Antibody, APC-Cy7 Conjugated
bsm-63322R-APC-Cy7 100 µL

Phospho-ERK1 (T202/Y204) /ERK2 (T185/Y187) Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details