Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CXCL16, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. Animal-Free CXCL16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCXCL16 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CXCL16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cxcl16-protein-mouse-his.html

Purity

98.00

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZN813 rabbit pAb
RA36566-01 50 µL

ZN813 rabbit pAb

Sign In for Pricing
View Details
ZN813 rabbit pAb
RA36566-02 100 µL

ZN813 rabbit pAb

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H7]
TA805433AM 100 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H7]

Sign In for Pricing
View Details
Tropomyosin γ shRNA Plasmid (h)
sc-43480-SH 20 µg

Tropomyosin γ shRNA Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human BTN3A3 shRNA (UAS) - Lentiviral human BTN3A3 shRNA (UAS, RFP) plasmid
GTR15349108 1 Vial

Lentiviral human BTN3A3 shRNA (UAS) - Lentiviral human BTN3A3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Complexin-2 Antibody
NBP3-17821-100ul 100 µL

Rabbit Polyclonal Complexin-2 Antibody

Sign In for Pricing
View Details