Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-2/CCL8, Human

MCP-2/CCL8 Protein, Human is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MCP-2/CCL8 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-human.html

Purity

98.0

Smiles

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Molecular Formula

6355 (Gene_ID) P80075 (Q24-P99) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Jian Zhou, et al. MCP2 activates NF-κB signaling pathway promoting the migration and invasion of ESCC cells. Cell Biol Int. 2018 Mar;42 (3) :365-372.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BCA-1 Human, Recombinant (B Cell Attracting Chemokine1, B Lymphocyte Chemoattractant, BLC, CXCL13, BLR1 Ligand) (MaxLight 405) discontinued
B0395-05-ML405 100 µL

BCA-1 Human, Recombinant (B Cell Attracting Chemokine1, B Lymphocyte Chemoattractant, BLC, CXCL13, BLR1 Ligand) (MaxLight 405) discontinued

Ask
View Details
Human CT47A2 qPCR Primer Pair
QH81869S 200 Tests

Human CT47A2 qPCR Primer Pair

Ask
View Details
Camel Lipoic Acid Synthetase (LIAS) ELISA Kit
MBS9920255-01 48 Well

Camel Lipoic Acid Synthetase (LIAS) ELISA Kit

Ask
View Details
Camel Lipoic Acid Synthetase (LIAS) ELISA Kit
MBS9920255-02 96 Well

Camel Lipoic Acid Synthetase (LIAS) ELISA Kit

Ask
View Details
Camel Lipoic Acid Synthetase (LIAS) ELISA Kit
MBS9920255-03 5x 96 Well

Camel Lipoic Acid Synthetase (LIAS) ELISA Kit

Ask
View Details
Camel Lipoic Acid Synthetase (LIAS) ELISA Kit
MBS9920255-04 10x 96 Well

Camel Lipoic Acid Synthetase (LIAS) ELISA Kit

Ask
View Details