Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-2/CCL8, Human

MCP-2/CCL8 Protein, Human is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MCP-2/CCL8 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-human.html

Purity

98.0

Smiles

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Molecular Formula

6355 (Gene_ID) P80075 (Q24-P99) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Jian Zhou, et al. MCP2 activates NF-κB signaling pathway promoting the migration and invasion of ESCC cells. Cell Biol Int. 2018 Mar;42 (3) :365-372.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66, Biliary GlycoProtein, BGP-1, CEA) (BSA & Azide Free) (MaxLight 405)
MBS6193937-01 0.1 mL

Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66, Biliary GlycoProtein, BGP-1, CEA) (BSA & Azide Free) (MaxLight 405)

Ask
View Details
Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66, Biliary GlycoProtein, BGP-1, CEA) (BSA & Azide Free) (MaxLight 405)
MBS6193937-02 5x 0.1 mL

Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66, Biliary GlycoProtein, BGP-1, CEA) (BSA & Azide Free) (MaxLight 405)

Ask
View Details
Rabbit Monoclonal Glycophorin A Antibody (GYPA/3219R) [DyLight 680]
NBP3-08261FR 100 µL

Rabbit Monoclonal Glycophorin A Antibody (GYPA/3219R) [DyLight 680]

Ask
View Details
CLEC12B (NM_001129998) Human Over-expression Lysate
LS387837-100ug 100 µg

CLEC12B (NM_001129998) Human Over-expression Lysate

Ask
View Details
Shank2 (NM_001081370) Mouse Tagged ORF Clone
MG218816 10 µg

Shank2 (NM_001081370) Mouse Tagged ORF Clone

Ask
View Details
EphA3 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-43620R-APC-Cy5.5 100 µL

EphA3 Polyclonal Antibody, APC-Cy5.5 Conjugated

Ask
View Details