Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-2/CCL8, Human

MCP-2/CCL8 Protein, Human is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MCP-2/CCL8 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-human.html

Purity

98.0

Smiles

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Molecular Formula

6355 (Gene_ID) P80075 (Q24-P99) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Jian Zhou, et al. MCP2 activates NF-κB signaling pathway promoting the migration and invasion of ESCC cells. Cell Biol Int. 2018 Mar;42 (3) :365-372.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Serglycin (SRGN) ELISA Kit
RK07602 96 Tests

Mouse Serglycin (SRGN) ELISA Kit

Ask
View Details
T2R48 Rabbit Polyclonal Antibody
E28PT4512 100 µL

T2R48 Rabbit Polyclonal Antibody

Ask
View Details
AdmiRa-Off-hsa-miR-4737 Virus
mh6716 1.0 mL

AdmiRa-Off-hsa-miR-4737 Virus

Ask
View Details
HPLC Column, Phenyl-Ether,5μm,120Å,4.6x150mm
13021396 1 PC

HPLC Column, Phenyl-Ether,5μm,120Å,4.6x150mm

Ask
View Details
Rotor with Lid, for use with GCC-MP Series
GCC-MP-5ML 1 Each

Rotor with Lid, for use with GCC-MP Series

Ask
View Details
Nori® Canine beta-Endophin ELISA Kit
GR115498 96 Well

Nori® Canine beta-Endophin ELISA Kit

Ask
View Details