Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Mouse (HEK293, His)

CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-mouse-hek293-his.html

Purity

95.00

Smiles

DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH

Molecular Formula

66205 (Gene_ID) Q9DCG2-2 (D21-H156) (Accession)

Molecular Weight

Approximately 19-23 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Methoxy-5-methylphenyl) methanethiol
RQB76153-01 50 mg

(2-Methoxy-5-methylphenyl) methanethiol

Sign In for Pricing
View Details
(2-Methoxy-5-methylphenyl) methanethiol
RQB76153-02 0.5 g

(2-Methoxy-5-methylphenyl) methanethiol

Sign In for Pricing
View Details
SEC14L1 (NM_001039573) Human 3' UTR Clone
SC207406 10 µg

SEC14L1 (NM_001039573) Human 3' UTR Clone

Sign In for Pricing
View Details
Olr1117 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
33682066 1.0 µg DNA

Olr1117 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CDK7 Antibody
E91694 100 µL

CDK7 Antibody

Sign In for Pricing
View Details
Rabbit Pyruvate kinase isozymes M1/M2 (PKM2) ELISA Kit
EK8490 48 Tests

Rabbit Pyruvate kinase isozymes M1/M2 (PKM2) ELISA Kit

Sign In for Pricing
View Details