Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR1, Rat (HEK293, hFc)

Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. ACVR1 Protein, Rat (HEK293, hFc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 103 amino acids (M21-E123) .

Product Specifications

Product Name Alternative

ACVR1 Protein, Rat (HEK293, hFc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr1-protein-rat-hek293-hfc.html

Purity

97.70

Smiles

MEDEEPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSVNDGFRVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNVTARLPTKGKSFPGSQNFHLE

Molecular Formula

79558 (Gene_ID) P80201 (M21-E123) (Accession)

Molecular Weight

Approximately 43-48 kDa

References & Citations

[1]José Antonio Valer, et al. ACVR1 Function in Health and Disease. Cells. 2019 Oct 31;8 (11) :1366.|[2]Jing Pang, et al. ACVR1-Fc suppresses BMP signaling and chondro-osseous differentiation in an in vitro model of Fibrodysplasia ossificans progressive. Bone. 2016 Nov;92:29-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details