Adiponectin/Acrp30, Bovine (P.pastoris, His)
Adiponectin/Acrp30 Protein, Bovine (P.pastoris, His) can increase cell sensitivity to insulin and can be used as a potential protein for diabetic tendinopathy research[1].
Product Specifications
Product Name Alternative
Adiponectin/Acrp30 Protein, Bovine (P.pastoris, His), Bovine, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/adiponectin-adipoq-protein-bovine-p-pastoris-his.html
Purity
90.00
Smiles
EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Molecular Formula
282865 (Gene_ID) Q3Y5Z3 (E18-E240) (Accession)
Molecular Weight
Approximately 27 kDa
References & Citations
[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-K548330-50MG 50 mg
alpha-Ketoisovaleric Acid, Sodium Salt (13C5)
Sign In for Pricing
View Details 
GTR10420410 96 Well
Human Xeroderma Pigmentosum, Complementation Group D ELISA kit
Sign In for Pricing
View Details 
MBS7216897-01 48 Well
Human Metabotropic glutamate receptor 3 (GRM3) ELISA Kit
Sign In for Pricing
View Details MBS7216897-02 96 Well
Human Metabotropic glutamate receptor 3 (GRM3) ELISA Kit
Sign In for Pricing
View Details MBS7216897-03 5x 96 Well
Human Metabotropic glutamate receptor 3 (GRM3) ELISA Kit
Sign In for Pricing
View Details MBS7216897-04 10x 96 Well
Human Metabotropic glutamate receptor 3 (GRM3) ELISA Kit
Sign In for Pricing
View Details