Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Rat (sf9, His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Rat (sf9, His) is produced in Sf9 insect cells with a N-Terminal His-tag. It consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Rat (sf9, His), Rat, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-rat-sf9-his.html

Purity

97.70

Smiles

SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI

Molecular Formula

25453 (Gene_ID) Q07731-1 (S78-I211) (Accession)

Molecular Weight

Approximately 20 kDa

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Shizuka Takaku, et al. GDNF promotes neurite outgrowth and upregulates galectin-1 through the RET/PI3K signaling in cultured adult rat dorsal root ganglion neurons. Neurochem Int. 2013 Feb;62 (3) :330-9.|[4]Piotr Hadaczek, et al. Pharmacokinetics and bioactivity of glial cell line-derived factor (GDNF) and neurturin (NTN) infused into the rat brain. Neuropharmacology. 2010 Jun;58 (7) :1114-21.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human GPR32 shRNA Plasmid
abx951916-01 150 µg

Human GPR32 shRNA Plasmid

Ask
View Details
Human GPR32 shRNA Plasmid
abx951916-02 300 µg

Human GPR32 shRNA Plasmid

Ask
View Details
Recombinant Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2) , partial
MBS7078907 Inquire

Recombinant Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2) , partial

Ask
View Details
Goat Very Late Appearing antigen-4 (VLA-4) ELISA Kit
EIA06524Go 1 Kit

Goat Very Late Appearing antigen-4 (VLA-4) ELISA Kit

Ask
View Details
PKC zeta Recombinant Protein Antigen
NBP1-87270PEP 0.1 mL

PKC zeta Recombinant Protein Antigen

Ask
View Details