Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium acetobutylicum Acetoacetate decarboxylase (adc)

Product Specifications

Product Name Alternative

(AAD) (ADC)

Abbreviation

Recombinant Clostridium acetobutylicum Acetoacetate decarboxylase protein

Gene Name

Adc

UniProt

P23670

Expression Region

1-244aa

Organism

Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Target Sequence

MLKDEVIKQISTPLTSPAFPRGPYKFHNREYFNIVYRTDMDALRKVVPEPLEIDEPLVRFEIMAMHDTSGLGCYTESGQAIPVSFNGVKGDYLHMMYLDNEPAIAVGRELSAYPKKLGYPKLFVDSDTLVGTLDYGKLRVATATMGYKHKALDANEAKDQICRPNYMLKIIPNYDGSPRICELINAKITDVTVHEAWTGPTRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEVIYDYLK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Catalyzes the conversion of acetoacetate to acetone and carbon dioxide.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.8 kDa

References & Citations

"The origin of the electrostatic perturbation in acetoacetate decarboxylase." Ho MC, Ménétret JF, Tsuruta H, Allen KN. Nature 459 393-7 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgtp2 sgRNA CRISPR Lentivector set (Mouse)
K3219401 3x 1.0 µg

Tgtp2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
MOCS3P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV770667 1.0 µg DNA

MOCS3P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Human ELF2
P2014-01 50 µg

Recombinant Human ELF2

Sign In for Pricing
View Details
Recombinant Human ELF2
P2014-02 200 µg

Recombinant Human ELF2

Sign In for Pricing
View Details
Recombinant Human ELF2
P2014-03 1 mg

Recombinant Human ELF2

Sign In for Pricing
View Details
Human FGF-13 1B Affinity Purified Polyclonal Ab
AF1909-SP 25 µg

Human FGF-13 1B Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details