Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R6 Protein Vector (Mouse) (pPM-C-His)
PV216265 500 ng

PIK3R6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MIR3617 Human qPCR Template Standard (MI0016007)
HK300829 200 Reactions

MIR3617 Human qPCR Template Standard (MI0016007)

Sign In for Pricing
View Details
(24R,25R) -3Alpha,7alpha,12alpha,24-Tetrahydroxy-5beta-cholestan-26-oyl-CoA
HY-CE00053 1 Each

(24R,25R) -3Alpha,7alpha,12alpha,24-Tetrahydroxy-5beta-cholestan-26-oyl-CoA

Sign In for Pricing
View Details
Ndufb5 Rat shRNA Lentiviral Particle (Locus ID 294964)
TL705007V 500 µL Each

Ndufb5 Rat shRNA Lentiviral Particle (Locus ID 294964)

Sign In for Pricing
View Details
4α-Phorbol 12,13-didecanoate
HY-116291 1 mg

4α-Phorbol 12,13-didecanoate

Sign In for Pricing
View Details
Human iPSC From Fibroblast-Alzheimer Disease
ABC-SC139G 1 Vial

Human iPSC From Fibroblast-Alzheimer Disease

Sign In for Pricing
View Details