Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK5, Recombinant, Human, GST-Tag (Never In Mitosis Gene A-related Kinase 5) discontinued
500301 10 µg

NEK5, Recombinant, Human, GST-Tag (Never In Mitosis Gene A-related Kinase 5) discontinued

Sign In for Pricing
View Details
RPL12P40 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV776506 1.0 µg DNA

RPL12P40 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TMEM150A Antibody
A59842-100UG 100 µg

TMEM150A Antibody

Sign In for Pricing
View Details
HSF1 (Heat Shock Factor 1, Heat Shock Factor Protein 1, Heat Shock Transcription Factor 1, HSF 1, hsf1, HSF1, HSTF 1, HSTF1)
319610 100 µL

HSF1 (Heat Shock Factor 1, Heat Shock Factor Protein 1, Heat Shock Transcription Factor 1, HSF 1, hsf1, HSF1, HSTF 1, HSTF1)

Sign In for Pricing
View Details
HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (APC)
127909-APC 100 µL

HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (APC)

Sign In for Pricing
View Details
Mouse Monoclonal CD90/Thy1 Antibody (AF-9) [PE/Cy5.5]
NBP2-47755PECY55 0.1 mL

Mouse Monoclonal CD90/Thy1 Antibody (AF-9) [PE/Cy5.5]

Sign In for Pricing
View Details