Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku80 (XRCC5) Rabbit Polyclonal Antibody
AP01251PU-N 100 µg

Ku80 (XRCC5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBXL4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
20303151 3x 1.0 µg DNA

FBXL4 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
MIC7 3'UTR Luciferase Stable Cell Line
TU013341 1.0 mL

MIC7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NCBP2 antibody
10R-1699 100 ug

NCBP2 antibody

Sign In for Pricing
View Details
Fscn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4629004 1.0 µg DNA

Fscn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Bordetella avium Ribonuclease 3 (rnc)
MBS1329870-01 0.02 mg (E-Coli)

Recombinant Bordetella avium Ribonuclease 3 (rnc)

Sign In for Pricing
View Details