Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF672 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV701725 1.0 µg DNA

ZNF672 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Sodium Carbonate Anhydrous
41900076-2 1 Kg

Sodium Carbonate Anhydrous

Sign In for Pricing
View Details
Aifm1 Mouse shRNA Lentiviral Particle (Locus ID 26926)
TL502649V 500 µL Each

Aifm1 Mouse shRNA Lentiviral Particle (Locus ID 26926)

Sign In for Pricing
View Details
Cdc37 Rabbit Polyclonal Antibody
APRab08514-01 20 µL

Cdc37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdc37 Rabbit Polyclonal Antibody
APRab08514-02 50 µL

Cdc37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdc37 Rabbit Polyclonal Antibody
APRab08514-03 100 µL

Cdc37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details