Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMPPB (GDP-Mannose Pyrophosphorylase B, KIAA1851, GTP-mannose-1-phosphate Guanylyltransferase beta, Mannose-1-Phosphate Guanylyltransferase beta) (MaxLight 490)
127401-ML490 100 µL

GMPPB (GDP-Mannose Pyrophosphorylase B, KIAA1851, GTP-mannose-1-phosphate Guanylyltransferase beta, Mannose-1-Phosphate Guanylyltransferase beta) (MaxLight 490)

Sign In for Pricing
View Details
Plekha2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4469105 3x 1.0 µg

Plekha2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-PCNA Antibody [SY12-07]
ET1605-38TR 20 µL

Anti-PCNA Antibody [SY12-07]

Sign In for Pricing
View Details
KHDRBS2 (KH Domain Containing, RNA Binding, Signal transduction Associated 2, FLJ38664, MGC26664, SLM-1, SLM1, bA535F17.1)
247844 50 µL

KHDRBS2 (KH Domain Containing, RNA Binding, Signal transduction Associated 2, FLJ38664, MGC26664, SLM-1, SLM1, bA535F17.1)

Sign In for Pricing
View Details
Npffr2 3'UTR Luciferase Stable Cell Line
TU214122 1.0 mL

Npffr2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human parainfluenza 3 virus Matrix protein (M)
MBS1208576-01 0.05 mg (E-Coli)

Recombinant Human parainfluenza 3 virus Matrix protein (M)

Sign In for Pricing
View Details