Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDCBP2 Protein Vector (Human) (pPM-C-HA)
43239021 500 ng

SDCBP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor 121 (VEGF121) BioAssayTM ELISA Kit (Rabbit)
028824 96 Tests

Vascular Endothelial Growth Factor 121 (VEGF121) BioAssayTM ELISA Kit (Rabbit)

Sign In for Pricing
View Details
MRGRF Antibody
MBS8510020-01 0.1 mg

MRGRF Antibody

Sign In for Pricing
View Details
MRGRF Antibody
MBS8510020-02 0.1 mL (AF635)

MRGRF Antibody

Sign In for Pricing
View Details
MRGRF Antibody
MBS8510020-03 0.1 mL (AF610)

MRGRF Antibody

Sign In for Pricing
View Details
MRGRF Antibody
MBS8510020-04 0.1 mL (AF405S)

MRGRF Antibody

Sign In for Pricing
View Details