Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sf1 shRNA (UAS) - Lentiviral mouse Sf1 shRNA (UAS, GFP) (100)
GTR15195201 1 Vial

Lentiviral mouse Sf1 shRNA (UAS) - Lentiviral mouse Sf1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
HtrA3 (Serine Protease HTRA3, 3421-, High-temperature requirement Factor A3, Pregnancy-Related Serine Protease, HTRA3, PRSP) (MaxLight 650) discontinued
302494-ML650 100 µL

HtrA3 (Serine Protease HTRA3, 3421-, High-temperature requirement Factor A3, Pregnancy-Related Serine Protease, HTRA3, PRSP) (MaxLight 650) discontinued

Sign In for Pricing
View Details
FGFRL1 (NM_001004356) Human Tagged ORF Clone
RC207730 10 µg

FGFRL1 (NM_001004356) Human Tagged ORF Clone

Sign In for Pricing
View Details
ST14 (HAI, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14, Suppression of Tumorigenicity 14) (MaxLight 405)
MBS6449621-01 0.1 mL

ST14 (HAI, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14, Suppression of Tumorigenicity 14) (MaxLight 405)

Sign In for Pricing
View Details
ST14 (HAI, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14, Suppression of Tumorigenicity 14) (MaxLight 405)
MBS6449621-02 5x 0.1 mL

ST14 (HAI, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14, Suppression of Tumorigenicity 14) (MaxLight 405)

Sign In for Pricing
View Details
PMM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV627736 1.0 µg DNA

PMM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details