Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OLIG1 shRNA (UAS) - Lentiviral human OLIG1 shRNA (UAS, iRFP) (25)
GTR15088274 1 Vial

Lentiviral human OLIG1 shRNA (UAS) - Lentiviral human OLIG1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mouse UCN3 (Urocortin 3) ELISA Kit
EK246921 96 Well

Mouse UCN3 (Urocortin 3) ELISA Kit

Sign In for Pricing
View Details
MPPED1 Antibody, FITC conjugated
A28794-100UG 100 µg

MPPED1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Lentiviral mouse Sh3pxd2b shRNA (UAS) - Lentiviral mouse Sh3pxd2b shRNA (UAS, GFP) plasmid
GTR15228166 1 Vial

Lentiviral mouse Sh3pxd2b shRNA (UAS) - Lentiviral mouse Sh3pxd2b shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Epsin 2 (EPN2) (NM_148921) Human Recombinant Protein
TP310899 20 µg

Epsin 2 (EPN2) (NM_148921) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (CA8/8605R)
NBP3-26749-20ug 20 µg

Rabbit Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (CA8/8605R)

Sign In for Pricing
View Details