Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAN Binding Protein 9 (RANBP9) ELISA Kit
abx382680 96 Tests

Human RAN Binding Protein 9 (RANBP9) ELISA Kit

Sign In for Pricing
View Details
Rad23b (NM_001025275) Rat Untagged Clone
RN206363 10 µg

Rad23b (NM_001025275) Rat Untagged Clone

Sign In for Pricing
View Details
TRIB3, NT (Tribbles Homolog 3, Neuronal Cell Death Inducible Putative Kinase, p65-interacting Inhibitor of NF-kappa-B, SINK, TRB-3, C20orf97, NIPK, SKIP3, TRB3) (Azide free) (HRP)
MBS6503579-01 0.2 mL

TRIB3, NT (Tribbles Homolog 3, Neuronal Cell Death Inducible Putative Kinase, p65-interacting Inhibitor of NF-kappa-B, SINK, TRB-3, C20orf97, NIPK, SKIP3, TRB3) (Azide free) (HRP)

Sign In for Pricing
View Details
TRIB3, NT (Tribbles Homolog 3, Neuronal Cell Death Inducible Putative Kinase, p65-interacting Inhibitor of NF-kappa-B, SINK, TRB-3, C20orf97, NIPK, SKIP3, TRB3) (Azide free) (HRP)
MBS6503579-02 5x 0.2 mL

TRIB3, NT (Tribbles Homolog 3, Neuronal Cell Death Inducible Putative Kinase, p65-interacting Inhibitor of NF-kappa-B, SINK, TRB-3, C20orf97, NIPK, SKIP3, TRB3) (Azide free) (HRP)

Sign In for Pricing
View Details
WDR93, CT (WDR93, WD repeat-containing protein 93) (MaxLight 490) discontinued
043863-ML490 100 µL

WDR93, CT (WDR93, WD repeat-containing protein 93) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SCTR (Secretin Receptor) Chicken ELISA Kit
G9106 96 Tests

SCTR (Secretin Receptor) Chicken ELISA Kit

Sign In for Pricing
View Details