Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Angiopoietin-like 3 Quantikine ELISA Kit
MANL30 96 Tests

Mouse Angiopoietin-like 3 Quantikine ELISA Kit

Sign In for Pricing
View Details
CENPH Protein (N-His, Human)
P502448 100 µg

CENPH Protein (N-His, Human)

Sign In for Pricing
View Details
DSG4 sgRNA CRISPR Lentivector set (Human)
K0634601 3x 1.0 µg

DSG4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MORAb-066
HY-P991378 1 Each

MORAb-066

Sign In for Pricing
View Details
TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) (MaxLight 650)
134618-ML650 100 µL

TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF536 Antibody [DyLight 755]
NBP1-77092IR 0.1 mL

Rabbit Polyclonal ZNF536 Antibody [DyLight 755]

Sign In for Pricing
View Details