Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC86 Recombinant Protein (Rat)
RP193580 100 µg

CCDC86 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human Cysteine Rich Secretory Protein 3 (CRISP3) ELISA Kit
QY-E04211 96 Tests

Human Cysteine Rich Secretory Protein 3 (CRISP3) ELISA Kit

Sign In for Pricing
View Details
VGluT1 (SLC17A7) Goat Polyclonal Antibody
TA317309 50 µg

VGluT1 (SLC17A7) Goat Polyclonal Antibody

Sign In for Pricing
View Details
6-TET Alkyne
T8380 5 mg

6-TET Alkyne

Sign In for Pricing
View Details
Apex2 Mouse siRNA Oligo Duplex (Locus ID 77622)
SR416495 1 Kit

Apex2 Mouse siRNA Oligo Duplex (Locus ID 77622)

Sign In for Pricing
View Details
Cd209d (NM_130904) Mouse Untagged Clone
MC212338 10 µg

Cd209d (NM_130904) Mouse Untagged Clone

Sign In for Pricing
View Details