Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal p53 Antibody
TA326387 100 µg

Mouse monoclonal p53 Antibody

Sign In for Pricing
View Details
Xpress™ Human ETV3 Over-expressing Stable Cell Line
ABC-X1018 1 Vial

Xpress™ Human ETV3 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Guanosine
RM465-10G 1 unit

Guanosine

Sign In for Pricing
View Details
PRTFDC1 Protein, Human, Recombinant (His Tag)
PH51159E1 100 µg

PRTFDC1 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
OR5BT1P ORF Vector (Human) (pORF)
ORF026983 1.0 µg DNA

OR5BT1P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund Carnitine operon protein CaiE (caiE)
MBS1046206-01 0.02 mg (E-Coli)

Recombinant Salmonella schwarzengrund Carnitine operon protein CaiE (caiE)

Sign In for Pricing
View Details