Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAC14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2478105 3x 1.0 µg

TRNAC14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human RUVBL2 shRNA (UAS) - Lentiviral human RUVBL2 shRNA (UAS, RFP) plasmid
GTR15092545 1 Vial

Lentiviral human RUVBL2 shRNA (UAS) - Lentiviral human RUVBL2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Miga2 (NM_175392) Mouse Tagged ORF Clone
MG209238 10 µg

Miga2 (NM_175392) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Goat anti Tetanus Toxoid
MBS315073-01 1 mL

Goat anti Tetanus Toxoid

Sign In for Pricing
View Details
Goat anti Tetanus Toxoid
MBS315073-02 5x 1 mL

Goat anti Tetanus Toxoid

Sign In for Pricing
View Details
NSUN5B (NM_001039576) Human Tagged ORF Clone Lentiviral Particle
RC217277L4V 200 µL

NSUN5B (NM_001039576) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details