Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RBBP9 Antibody (OTI4G3) - Azide and BSA Free
NBP2-73828 100 µg

Mouse Monoclonal RBBP9 Antibody (OTI4G3) - Azide and BSA Free

Sign In for Pricing
View Details
Lentiviral mouse Csmd3 shRNA (UAS) - Lentiviral mouse Csmd3 shRNA (UAS, RFP) plasmid
GTR15220693 1 Vial

Lentiviral mouse Csmd3 shRNA (UAS) - Lentiviral mouse Csmd3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (MaxLight 550)
127091-ML550 100 µL

GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni purC Protein (aa 1-236) (strain 81-176)
VAng-Ly2284-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni purC Protein (aa 1-236) (strain 81-176)

Sign In for Pricing
View Details
Rabbit Polyclonal PSAT1 Antibody [Janelia Fluor 646]
NBP2-99608JF646 0.1 mL

Rabbit Polyclonal PSAT1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
HIS Tag Antibody, HRP Conjugate [AMM22193G]
AMM22193G-01 100 µL

HIS Tag Antibody, HRP Conjugate [AMM22193G]

Sign In for Pricing
View Details