Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin L1, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Product Specifications

Product Name Alternative

Cathepsin L1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-l-protein-mouse-hek293-his.html

Purity

93.90

Smiles

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Molecular Formula

13039 (Gene_ID) P06797 (T18-N334) (Accession)

Molecular Weight

Approximately 36.02 kDa.

References & Citations

[1]Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37 (12) :1606-1622.|[2]Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AgAuSe-COOH (1000 nm)
HY-D2194 1 Each

AgAuSe-COOH (1000 nm)

Sign In for Pricing
View Details
FAAH1 (FAAH) (NM_001441) Human Over-expression Lysate
LS002166-20ug 20 µg

FAAH1 (FAAH) (NM_001441) Human Over-expression Lysate

Sign In for Pricing
View Details
DNAJB5, CT (DNAJB5, HSC40, DnaJ homolog subfamily B member 5, Heat shock protein Hsp40-2, Heat shock protein Hsp40-3, Heat shock protein cognate 40) (MaxLight 550)
MBS6292692-01 0.1 mL

DNAJB5, CT (DNAJB5, HSC40, DnaJ homolog subfamily B member 5, Heat shock protein Hsp40-2, Heat shock protein Hsp40-3, Heat shock protein cognate 40) (MaxLight 550)

Sign In for Pricing
View Details
DNAJB5, CT (DNAJB5, HSC40, DnaJ homolog subfamily B member 5, Heat shock protein Hsp40-2, Heat shock protein Hsp40-3, Heat shock protein cognate 40) (MaxLight 550)
MBS6292692-02 5x 0.1 mL

DNAJB5, CT (DNAJB5, HSC40, DnaJ homolog subfamily B member 5, Heat shock protein Hsp40-2, Heat shock protein Hsp40-3, Heat shock protein cognate 40) (MaxLight 550)

Sign In for Pricing
View Details
KIAA1984 (CCDC183) Human shRNA Lentiviral Particle (Locus ID 84960)
TL311924V 500 µL Each

KIAA1984 (CCDC183) Human shRNA Lentiviral Particle (Locus ID 84960)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1233425-01 0.02 mg (E-Coli)

Recombinant Aeromonas hydrophila subsp. hydrophila UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details