Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Recombinant Antibody, Cy5 Conjugated
bsm-60806R-Cy5 100 µL

P53 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
C10orf57 Recombinant Protein Antigen
NBP2-68939PEP 100 µL

C10orf57 Recombinant Protein Antigen

Sign In for Pricing
View Details
SLC33A1 Protein Vector (Mouse) (pPM-C-HA)
PV230548 500 ng

SLC33A1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor beta ELISA Kit
MBS007546-01 48 Well

Rat Tumor Necrosis Factor beta ELISA Kit

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor beta ELISA Kit
MBS007546-02 96 Well

Rat Tumor Necrosis Factor beta ELISA Kit

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor beta ELISA Kit
MBS007546-03 5x 96 Well

Rat Tumor Necrosis Factor beta ELISA Kit

Sign In for Pricing
View Details