Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLPP Protein Vector (Human) (pPB-C-His)
PV069913 500 ng

CLPP Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PJHF1-Sting1-linker-mcherry Plasmid
PVT82545 2 µg

PJHF1-Sting1-linker-mcherry Plasmid

Sign In for Pricing
View Details
Cofilin 2 (MaxLight 490) discontinued
C7506-50-ML490 100 µL

Cofilin 2 (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant 10 kDa chaperonin (groS)
MBS1422295-01 0.05 mg (E-Coli)

Recombinant 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant 10 kDa chaperonin (groS)
MBS1422295-02 0.2 mg (E-Coli)

Recombinant 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant 10 kDa chaperonin (groS)
MBS1422295-03 0.05 mg (Yeast)

Recombinant 10 kDa chaperonin (groS)

Sign In for Pricing
View Details