Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itga5 (NM_010577) Mouse Recombinant Protein
TP511547 20 µg

Itga5 (NM_010577) Mouse Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 18 Antibody (KRT18/834)
NBP2-44948-0.1mg 0.1 mg

Mouse Monoclonal Cytokeratin 18 Antibody (KRT18/834)

Sign In for Pricing
View Details
SURB7 (Mediator Complex Subunit 21, SRB7, SURB7) (MaxLight 550)
252293-ML550 100 µL

SURB7 (Mediator Complex Subunit 21, SRB7, SURB7) (MaxLight 550)

Sign In for Pricing
View Details
Zinc Finger Protein 398 (ZNF398) Antibody (FITC)
abx306088-01 20 µg

Zinc Finger Protein 398 (ZNF398) Antibody (FITC)

Sign In for Pricing
View Details
Zinc Finger Protein 398 (ZNF398) Antibody (FITC)
abx306088-02 50 µg

Zinc Finger Protein 398 (ZNF398) Antibody (FITC)

Sign In for Pricing
View Details
Zinc Finger Protein 398 (ZNF398) Antibody (FITC)
abx306088-03 100 µg

Zinc Finger Protein 398 (ZNF398) Antibody (FITC)

Sign In for Pricing
View Details