Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spert ORF Vector (Mouse) (pORF)
45273014 1.0 µg DNA

Spert ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/1125 + ARG1/1126) [DyLight 680]
NBP2-48000FR 0.1 mL

Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/1125 + ARG1/1126) [DyLight 680]

Sign In for Pricing
View Details
Rabbit Polyclonal ENPP-2/Autotaxin Antibody [mFluor Violet 450 SE]
NBP2-98332MFV450 0.1 mL

Rabbit Polyclonal ENPP-2/Autotaxin Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660 (At5g65660)
MBS7036355-01 0.02 mg

Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660 (At5g65660)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660 (At5g65660)
MBS7036355-02 0.1 mg

Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660 (At5g65660)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660 (At5g65660)
MBS7036355-03 5x 0.1 mg

Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660 (At5g65660)

Sign In for Pricing
View Details