Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-Nitroacetophenone
TRC-N490300-10G 10 g

2'-Nitroacetophenone

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Interacting Protein (AIP) Antibody
abx037929-01 100 µg

Aryl Hydrocarbon Receptor Interacting Protein (AIP) Antibody

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Interacting Protein (AIP) Antibody
abx037929-02 1 mg

Aryl Hydrocarbon Receptor Interacting Protein (AIP) Antibody

Sign In for Pricing
View Details
Lentiviral human KCNS1 shRNA (UAS) - Lentiviral human KCNS1 shRNA (UAS, RFP) plasmid
GTR15081097 1 Vial

Lentiviral human KCNS1 shRNA (UAS) - Lentiviral human KCNS1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal AGTPBP1 Antibody [DyLight 405]
NBP3-06124V 0.1 mL

Rabbit Polyclonal AGTPBP1 Antibody [DyLight 405]

Sign In for Pricing
View Details
TMEM16A (ANO1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]
TA803592BM 100 µL

TMEM16A (ANO1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]

Sign In for Pricing
View Details