Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uts2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3971203 1.0 µg DNA

Uts2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ssbp3 (NM_023672) Mouse Tagged ORF Clone
MR217735 10 µg

Ssbp3 (NM_023672) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-SCNN1B (Thr615) Polyclonal Antibody
bs-5701R 100 µL

Phospho-SCNN1B (Thr615) Polyclonal Antibody

Sign In for Pricing
View Details
Cdc14A Polyclonal Antibody, Cy5 Conjugated
bs-8614R-Cy5 100 µL

Cdc14A Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Lipopolysaccharides from Escherichia coli O26:B6
B2016074 250 µg

Lipopolysaccharides from Escherichia coli O26:B6

Sign In for Pricing
View Details
Β-Hydroxybutyrate Dehydrogenase from Alcaligenes sp.
B2024714 5 KU

Β-Hydroxybutyrate Dehydrogenase from Alcaligenes sp.

Sign In for Pricing
View Details