Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Novobiocic acid
N071-0.5-MG 0.5 mg

Novobiocic acid

Sign In for Pricing
View Details
Chicken Solute carrier family 35 member F2 (SLC35F2) ELISA Kit
EIA06885Ch 1 Kit

Chicken Solute carrier family 35 member F2 (SLC35F2) ELISA Kit

Sign In for Pricing
View Details
USP39 Over-expression Lysate Product
GWB-A98DF8 0.1 mg

USP39 Over-expression Lysate Product

Sign In for Pricing
View Details
Mouse Monoclonal AKR1A1 Antibody (OTI6E3) [mFluor Violet 500 SE]
NBP2-71591MFV500 0.1 mL

Mouse Monoclonal AKR1A1 Antibody (OTI6E3) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Monkey Complement Factor P (CFP) ELISA Kit
abx359628 96 Well

Monkey Complement Factor P (CFP) ELISA Kit

Sign In for Pricing
View Details
Keratin K19 antibody
MBS831329-01 1 mL

Keratin K19 antibody

Sign In for Pricing
View Details