Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYK5 (STRADA) (NM_001003788) Human 3' UTR Clone
SC209976 10 µg

LYK5 (STRADA) (NM_001003788) Human 3' UTR Clone

Sign In for Pricing
View Details
Mouse Monoclonal EGFR Antibody (EGFR1) [Janelia Fluor 646]
NB200-206JF646 0.1 mL

Mouse Monoclonal EGFR Antibody (EGFR1) [Janelia Fluor 646]

Sign In for Pricing
View Details
PCD17 rabbit pAb
E44H16069 100 µL

PCD17 rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal MUC7 Antibody (4D2-1D7) [DyLight 488]
NBP2-50391G 0.1 mL

Mouse Monoclonal MUC7 Antibody (4D2-1D7) [DyLight 488]

Sign In for Pricing
View Details
Chicken Slit2 ELISA Kit
ECKS0119 96 Tests

Chicken Slit2 ELISA Kit

Sign In for Pricing
View Details
MCP2 (Macrophage/Monocyte Chemotactic Protein 2, Chemokine C-C Motif Ligand 8, CCL8, HC14, Monocyte Chemotactic Protein 2, Small Inducible Cytokine A8 Precursor, SCYA8, SCYA10) (Biotin) discontinued
M2750-12B-01 25 µg

MCP2 (Macrophage/Monocyte Chemotactic Protein 2, Chemokine C-C Motif Ligand 8, CCL8, HC14, Monocyte Chemotactic Protein 2, Small Inducible Cytokine A8 Precursor, SCYA8, SCYA10) (Biotin) discontinued

Sign In for Pricing
View Details