PDGF-CC, Cynomolgus (HEK293, hFc)
Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html
Purity
95.00
Smiles
VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Molecular Formula
/ (Gene_ID) EHH54037 (V196-G306) (Accession)
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PKMYT1 (NM_004203) Human Tagged ORF Clone Lentiviral Particle
OR4F7P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
SMYD2 (SET and MYND Domain-containing Protein 2, N-lysine methyltransferase SMYD2, Histone Methyltransferase SMYD2, HSKM-B, Lysine N-methyltransferase 3C, KMT3C, ZMYND14) (MaxLight 405) discontinued