Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Cynomolgus (HEK293, hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-cynomolgus-hek293-hfc.html

Purity

95.00

Smiles

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Formula

/ (Gene_ID) EHH54037 (V196-G306) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF10 Antibody [Alexa Fluor 350]
NBP2-59679AF350 0.1 mL

Rabbit Polyclonal ZNF10 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Guinea Pig F11 ELISA Kit
EGF0033 96 Tests

Guinea Pig F11 ELISA Kit

Sign In for Pricing
View Details
Krt36 Rat shRNA Plasmid (Locus ID 287698)
TL701097 1 Kit

Krt36 Rat shRNA Plasmid (Locus ID 287698)

Sign In for Pricing
View Details
Heat Shock 110 kDa Protein (HSP110) Antibody (ATTO 565)
abx446894 100 µg

Heat Shock 110 kDa Protein (HSP110) Antibody (ATTO 565)

Sign In for Pricing
View Details
Recombinant Streptococcus Equi secA Protein (aa 1-842)
VAng-Cr7571-inquire Inquire

Recombinant Streptococcus Equi secA Protein (aa 1-842)

Sign In for Pricing
View Details
Recombinant Corin (CRN)
SIPG734Hu03-01 10 µg

Recombinant Corin (CRN)

Sign In for Pricing
View Details