Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caspase-1/CASP1 p20, Human (GST)

Caspase-1/CASP1 is a thiol protease complex involved in inflammation by catalyzing the cleavage of IL1B, IL18, and Gasdermin-D (GSDMD) . It activates a pro-inflammatory response, releases mature cytokines IL1B and IL18, and initiates pyroptosis through cleavage of GSDMD. Caspase-1/CASP1 Protein, Human (GST) is the recombinant human-derived Caspase-1/CASP1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Caspase-1/CASP1 p20 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/casp1-protein-human-gst.html

Purity

90.00

Smiles

NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN

Molecular Formula

834 (Gene_ID) P29466 (N120-N269) (Accession)

Molecular Weight

Approximately 43.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD8 Human Recombinant Protein, Synthetic Nanodisc
TP721613M 100 µg

FZD8 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
POLR3B Rabbit Polyclonal Antibody
orb319011-01 30 µL

POLR3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLR3B Rabbit Polyclonal Antibody
orb319011-02 50 μL

POLR3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLR3B Rabbit Polyclonal Antibody
orb319011-03 100 µL

POLR3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLR3B Rabbit Polyclonal Antibody
orb319011-04 200 µL

POLR3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Lactobacillus salivarius UPF0473 protein LSL_1108 (LSL_1108)
MBS1456631-01 0.02 mg (E-Coli)

Recombinant Lactobacillus salivarius UPF0473 protein LSL_1108 (LSL_1108)

Sign In for Pricing
View Details